LXL04_018870 | RubberDandelionOmics

Gene overview

LXL04_018870

Reference: OH-1004 Chr: Chr04 Coordinates: 19415780-19423520 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4377 bp · LXL04_018870|LXL04_018870|OH1004|cDNA

ATGATTTCTGTTGGGAGTAGAGATGGTAGGAAGGGGTTAAGTTTGAGGTATGGTGTTGAAGGTGGAGATATGGATTTAGAGGCTGAACTTGAAGAAGGAGAGGCCTGTTTTCAGAACAATAACGACGATGATTCCACAATTGACCCCGATGTTGCTCTCTCTTATATTGATGAGAAACTTCAAGATGTGTTGGGACATTTTCAGAAAGATTTTGAAGGTGGAGTTTCAGCTGAAAATTTGGGGGCAAAGTTTGGGGGATA...

CDS

Download CDS FASTA

4377 bp · LXL04_018870|LXL04_018870|OH1004|CDS

ATGATTTCTGTTGGGAGTAGAGATGGTAGGAAGGGGTTAAGTTTGAGGTATGGTGTTGAAGGTGGAGATATGGATTTAGAGGCTGAACTTGAAGAAGGAGAGGCCTGTTTTCAGAACAATAACGACGATGATTCCACAATTGACCCCGATGTTGCTCTCTCTTATATTGATGAGAAACTTCAAGATGTGTTGGGACATTTTCAGAAAGATTTTGAAGGTGGAGTTTCAGCTGAAAATTTGGGGGCAAAGTTTGGGGGATA...

Protein

Download Protein FASTA

1458 aa · LXL04_018870|LXL04_018870|OH1004|PROTEIN

MISVGSRDGRKGLSLRYGVEGGDMDLEAELEEGEACFQNNNDDDSTIDPDVALSYIDEKLQDVLGHFQKDFEGGVSAENLGAKFGGYGSFLPAYTRSPACPHPKTPPKIPTNNPSVSPNHMHIEGGRQSLVSISNISQSIKHGSVSTSGATTAPPPPPPPLKMNGKSKQEVHMLFNKNGGDKFASSNGQPVNNFANTCDPKSLKVRIKVGSDNLSTRKNAEIYSGLGLDVSPSSSLEASPVDSDDFCHMPNDSPHEESPT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018870`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018870

Location Chr04:19415780-19423520 (+)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0347300`	Binds to histones H3K4me1, H3K4me2 and H3K4me3 in GST pull-down assay.	No verified direct reference in this release
`Os07g0669800`	Transcriptional activator that acts as a positive regulator of grain size.	No verified direct reference in this release
`Os05g0371100`	Binds to histones H3K4me1, H3K4me2 and H3K4me3 in GST pull-down assay.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018870 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0080113 regulation of seed growth Biological Process

GO:0005634 nucleus Cellular Component

GO:0008270 zinc ion binding Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

dosa:Os03g0347300

dosa:Os05g0371100

dosa:Os07g0669800

osa:4344236

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.969

Rank 1 · LXL04_018870 · OH-1004

Cytoplasm0.075

Rank 2 · LXL04_018870 · OH-1004

Cell membrane0.041

Rank 3 · LXL04_018870 · OH-1004

Endoplasmic reticulum0.021

Rank 4 · LXL04_018870 · OH-1004

Plastid0.011

Rank 5 · LXL04_018870 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07496.22zf-CW587-632 aa

PF24756.2THD_CWZF3-5-71198-1457 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018870	`PF07496.22`	zf-CW	587	632	1.3e-16	61.0
LXL04_018870	`PF24756.2`	THD_CWZF3-5-7	1198	1457	5.1e-76	256.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0DRX6`	Oryza sativa subsp. japonica	Cysteine-tryptophan domain-containing zinc finger protein 3	48.889%	Swiss-Prot	weak database homology
`A0A0P0X9Z7`	Oryza sativa subsp. japonica	Cysteine-tryptophan domain-containing zinc finger protein 7	50.000%	Swiss-Prot	weak database homology
`Q0DIQ5`	Oryza sativa subsp. japonica	Cysteine-tryptophan domain-containing zinc finger protein 5	39.245%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card