TkA08G081190 | RubberDandelionOmics

Gene overview

TkA08G081190

Reference: TK1151 Chr: Chr08 Coordinates: 20864615-20869424 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2515 bp · TkA08G081190|TK1151|cDNA

GAGGGTTGTGGGGTGTACAATTTTGCCATAGAAAAAAAGCCGCCCTCCGTTTATAAACAGAAGTTTGAAAGATTGAAAAACGCACAAACTCAAAAACACCTTTTTCTTCTTCTTTGTCTCTCCTTAACTTTCGATCTTCTTTTACTGAAACTAAAGCAAACTTTGATGAAAAGCTTCCATTTTTATGGTGTTTCCAACCATGTCGTTCGAAATTAGCTGAAATCAGAAACATCCATCAAAGATTTCTTCGTGATTGATTG...

CDS

Download CDS FASTA

1554 bp · TkA08G081190|TK1151|CDS

ATGATGATGGGTGGTGTTGAATTACACCAAGAACTCAAGAATCTATGTGTTAACACTAACTGCTGGAAGTATGCTGTTTTTTGGAGACTTAATCATCAAGATCAAATGACATTGACTTGCGAAGATTTCTATTACGACAACATGAATGACAATTTGAGGGACGGGTGTTTTGCGAATGATCTTCTTGGATTAGAAGTTGTGAAGATGTCTTATTGTGTATACTCCATTGGAGAAGGGATGGTTGGACGGGTTGCAACTAC...

Protein

Download Protein FASTA

517 aa · TkA08G081190|TK1151|PROTEIN

MMMGGVELHQELKNLCVNTNCWKYAVFWRLNHQDQMTLTCEDFYYDNMNDNLRDGCFANDLLGLEVVKMSYCVYSIGEGMVGRVATTGKHLWKSGNQLVSLDEHLDGWRTQLKAGIRTIVAIAVSPYAVVQIGSLKTIPEDLKLVNRIQEIFFDLQCSLIASTNCSPCVTDLTTSSGSGRFHKHVNNTTEKNTWKTVEPIRNHQENEDPVSDFIQSTHSNDQNPNLFMPATSNCQNTNNPNESFMFPIGCELYEALGPAF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G081190`
TK1151 ID	TkA08G081190
OH-1004 ID	LXL04_018755
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G081190

Location Chr08:20864615-20869424 (+)

Description Similar to EMB1444: Transcription factor EMB1444

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g31280`	Transcription factor that may regulate root development.	No verified direct reference in this release
`At1g06150`	Transcription factor that may regulate root development.	No verified direct reference in this release
`At2g27230`	Transcription activator that regulates root development; promotes the production of stele cells in roots.	No verified direct reference in this release
`At1g64625`	Transcription factor that may regulate root development.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018755 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0010078 maintenance of root meristem identity Biological Process

GO:0010089 xylem development Biological Process

GO:0010479 stele development Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0048364 root development Biological Process

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

GO:0046983 protein dimerization activity Molecular Function

KEGG gene cross-reference

ath:AT1G06150

ath:AT2G27230

ath:AT2G31280

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.900

Rank 1 · TkA08G081190 · TK1151

Cytoplasm0.158

Rank 2 · TkA08G081190 · TK1151

Cell membrane0.043

Rank 3 · TkA08G081190 · TK1151

Endoplasmic reticulum0.026

Rank 4 · TkA08G081190 · TK1151

Plastid0.015

Rank 5 · TkA08G081190 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14215bHLH-MYC_N8-49 aa

PF14215bHLH-MYC_N63-152 aa

PF20925Htt_bridge200-240 aa

PF14215bHLH-MYC_N266-281 aa

PF22754bHLH-TF_ACT-like_plant282-302 aa

PF23176bHLH_LHW340-400 aa

PF00010HLH347-384 aa

PF22754bHLH-TF_ACT-like_plant443-478 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G081190	`PF14215`	bHLH-MYC_N	8	49	1e-26	95.0
TkA08G081190	`PF14215`	bHLH-MYC_N	63	152	1e-26	95.0
TkA08G081190	`PF20925`	Htt_bridge	200	240	0.05	13.5
TkA08G081190	`PF14215`	bHLH-MYC_N	266	281	1e-26	95.0
TkA08G081190	`PF22754`	bHLH-TF_ACT-like_plant	282	302	0.092	13.6
TkA08G081190	`PF23176`	bHLH_LHW	340	400	1.4e-36	124.9
TkA08G081190	`PF00010`	HLH	347	384	0.067	13.7
TkA08G081190	`PF22754`	bHLH-TF_ACT-like_plant	443	478	0.092	13.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q58G01`	Arabidopsis thaliana	sp\|Q58G01\|LHWL3_ARATH Transcription factor bHLH155	33.300%	Swiss-Prot	Medium
`P0C7P8`	Arabidopsis thaliana	sp\|P0C7P8\|LHWL1_ARATH Transcription factor EMB1444	60.000%	Swiss-Prot	Low
`Q9XIN0`	Arabidopsis thaliana	sp\|Q9XIN0\|LHW_ARATH Transcription factor LHW	49.400%	Swiss-Prot	Low
`Q7XJU0`	Arabidopsis thaliana	sp\|Q7XJU0\|LHWL2_ARATH Transcription factor bHLH157	28.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card