TkA08G079950 | RubberDandelionOmics

Gene overview

TkA08G079950

Reference: TK1151 Chr: Chr08 Coordinates: 20519797-20524983 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2423 bp · TkA08G079950|TK1151|cDNA

AACCAAATCATGTCTCCATTTCCCCGGTGGCGGCGAAAAGTCTCCGATGGATGCATAAAACTCAACAAATCCCCAACTAACTCCCATACGCCTTCTCCTCCACCATCAAACCCCTGGCCAGCCATCATAAGTCGCACCGGAGTCACGCAGGGCGAATGAAAACTCATTTAAAGTTCATCGTCGTCGTGTTAGTGATCGTCGCGGTTTTGGATAGAACCGCCGTCGTCAATGGCAGTCAGTTGAAGGGAGATTACTCCAAG...

CDS

Download CDS FASTA

1089 bp · TkA08G079950|TK1151|CDS

ATGAAAACTCATTTAAAGTTCATCGTCGTCGTGTTAGTGATCGTCGCGGTTTTGGATAGAACCGCCGTCGTCAATGGCAGTCAGTTGAAGGGAGATTACTCCAAGTTATCGGGGATTATTATACCAGGTTTTGCGTCTACTCAGCTCAGAGCCTGGTCTATTTTGGATTGCCCTTACTCCCCTCTAGATTTCAATCCTCTCGATTTGGTTTGGCTCGACACTACCAAAAGAAGGCTACAATCTACCATGCAGTGTCTTTC...

Protein

Download Protein FASTA

362 aa · TkA08G079950|TK1151|PROTEIN

MKTHLKFIVVVLVIVAVLDRTAVVNGSQLKGDYSKLSGIIIPGFASTQLRAWSILDCPYSPLDFNPLDLVWLDTTKRRLQSTMQCLSAMNCWLKCMMLDPYNQTDHPDCKSRPDSGLSAITELDPGYITGPLSSVWKEWLKWCIEFGIEANAILAVPYDWRLAPSKLEERDLYFHKLKLTFETALKHRGGPSIVFAHSLGNNVFRYFLEWLKLEIAPKRYIQWLDDHIHTYFAVGSPLLGSVQTVEATLSGFTFGLPVPE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G079950`
TK1151 ID	TkA08G079950
OH-1004 ID	LXL04_018721
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	92.800
Protein coverage (%)	TK1151 96.961 / OH-1004 54.714 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G079950

Location Chr08:20519797-20524983 (+)

Description Similar to PSAT: Phospholipid--sterol O-acyltransferase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g04010`	Involved in lipid catabolism.	Cellular sterol ester synthesis in plants is performed by an enzyme (phospholipid:sterol acyltransferase) different from the yeast and mammalian acyl-CoA:sterol acyltransferases.2005 · DOI: 10.1074/jbc.m504459200

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018721 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006071 glycerol metabolic process Biological Process

GO:0006629 lipid metabolic process Biological Process

GO:0006631 fatty acid metabolic process Biological Process

GO:0006650 glycerophospholipid metabolic process Biological Process

GO:0006651 diacylglycerol biosynthetic process Biological Process

GO:0006658 phosphatidylserine metabolic process Biological Process

GO:0006672 ceramide metabolic process Biological Process

GO:0010150 leaf senescence Biological Process

GO:0016127 sterol catabolic process Biological Process

GO:0019432 triglyceride biosynthetic process Biological Process

GO:0019915 lipid storage Biological Process

GO:0034638 phosphatidylcholine catabolic process Biological Process

KEGG gene cross-reference

ath:AT1G04010

ath:AT5G13640

bta:282271

sce:YNR008W

spo:2541187

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.369

Rank 1 · TkA08G079950 · TK1151

Endoplasmic reticulum0.302

Rank 2 · TkA08G079950 · TK1151

Golgi apparatus0.131

Rank 3 · TkA08G079950 · TK1151

Cytoplasm0.119

Rank 4 · TkA08G079950 · TK1151

Cell membrane0.075

Rank 5 · TkA08G079950 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02450LCAT70-331 aa

PF05057DUF676194-252 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G079950	`PF02450`	LCAT	70	331	5.3e-69	234.0
TkA08G079950	`PF05057`	DUF676	194	252	0.0066	16.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q4VCM1`	Arabidopsis thaliana	sp\|Q4VCM1\|LCAT2_ARATH Phospholipid--sterol O-acyltransferase	77.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card