Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1944 bp · LXL04_018721|LXL04_018721|OH1004|cDNA
ATGAAAACTCATTTAAAGTTCATCGTCGTCGTGTTAGTGATCGTCGCGGTTTTGGATAGAACCGCCGTCGTCAATGGCAGTCAGTTGAAGGGAGATTACTCCAAGTTATCGGGGATTATTATACCAGGTTTTGCGTCTACTCAGCTCAGAGCCTGGTCTATTTTGGATTGCCCTTACTCCCCTCTAGATTTCAATCCTCTCGATTTGGTTTGGCTCGACACTACCAAATGTCTTTCTGCAATGAATTGCTGGCTTAAATG...
1944 bp · LXL04_018721|LXL04_018721|OH1004|CDS
ATGAAAACTCATTTAAAGTTCATCGTCGTCGTGTTAGTGATCGTCGCGGTTTTGGATAGAACCGCCGTCGTCAATGGCAGTCAGTTGAAGGGAGATTACTCCAAGTTATCGGGGATTATTATACCAGGTTTTGCGTCTACTCAGCTCAGAGCCTGGTCTATTTTGGATTGCCCTTACTCCCCTCTAGATTTCAATCCTCTCGATTTGGTTTGGCTCGACACTACCAAATGTCTTTCTGCAATGAATTGCTGGCTTAAATG...
Protein
Download Protein FASTA647 aa · LXL04_018721|LXL04_018721|OH1004|PROTEIN
MKTHLKFIVVVLVIVAVLDRTAVVNGSQLKGDYSKLSGIIIPGFASTQLRAWSILDCPYSPLDFNPLDLVWLDTTKCLSAMNCWLKCMMLDPYNQTDHPDCKSRPDSGLSAITELDPGYITGPLSSVWKEWLKWCIEFGIEANAILAVPYDWRLAPSKLEERDLYFHKLKLTFETALKHRGGPSIVFAHSLGNNVFRYFLEWLKLEIAPKRYIQWLDDHIHTYFAVGSPLLGSVQTVEATLSGFTFGLPVPEGTARLMFN...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_018721 |
|---|---|
| TK1151 ID | TkA08G079950 |
| OH-1004 ID | LXL04_018721 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 92.800 |
| Protein coverage (%) | TK1151 96.961 / OH-1004 54.714Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_018721 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:17296405-17301156 (+) | |||||||||
| Description | Similar to PSAT: Phospholipid--sterol O-acyltransferase | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006071 glycerol metabolic process Biological Process GO:0006629 lipid metabolic process Biological Process GO:0006631 fatty acid metabolic process Biological Process GO:0006650 glycerophospholipid metabolic process Biological Process GO:0006651 diacylglycerol biosynthetic process Biological Process GO:0006658 phosphatidylserine metabolic process Biological Process GO:0006672 ceramide metabolic process Biological Process GO:0010150 leaf senescence Biological Process GO:0016127 sterol catabolic process Biological Process GO:0019432 triglyceride biosynthetic process Biological Process GO:0019915 lipid storage Biological Process GO:0034638 phosphatidylcholine catabolic process Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT1G04010 ath:AT5G13640 bta:282271 sce:YNR008W spo:2541187 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF02450.22LCAT68-497 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_018721 | PF02450.22 | LCAT | 68 | 497 | 1.3e-109 | 367.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.