TkA08G076430 | RubberDandelionOmics

Gene overview

TkA08G076430

Reference: TK1151 Chr: Chr08 Coordinates: 19630147-19631260 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

567 bp · TkA08G076430|TK1151|cDNA

ATGGAAGGACTCTCCGGACAAAACCCACTAAACACAATCAGGAGCTTGACCCGACTCCGCACGCTCAGCCTCCACAGAAACCTCCTCTCCGGCGTAATCCCGCAAGACCTGGAGTTTTGCTCTGAGCTCGGGATCCTTAACCTGCAAAACAACCGATTATCCGACGAAATCCCTGTGACTCTTTTTAGGCTTTCTAATTTAACTCGATTAGACATCTCGGCGCAACAATTTTGCTGGAGAAATATCGCCCAGTTTCAGCA...

CDS

Download CDS FASTA

567 bp · TkA08G076430|TK1151|CDS

ATGGAAGGACTCTCCGGACAAAACCCACTAAACACAATCAGGAGCTTGACCCGACTCCGCACGCTCAGCCTCCACAGAAACCTCCTCTCCGGCGTAATCCCGCAAGACCTGGAGTTTTGCTCTGAGCTCGGGATCCTTAACCTGCAAAACAACCGATTATCCGACGAAATCCCTGTGACTCTTTTTAGGCTTTCTAATTTAACTCGATTAGACATCTCGGCGCAACAATTTTGCTGGAGAAATATCGCCCAGTTTCAGCA...

Protein

Download Protein FASTA

188 aa · TkA08G076430|TK1151|PROTEIN

MEGLSGQNPLNTIRSLTRLRTLSLHRNLLSGVIPQDLEFCSELGILNLQNNRLSDEIPVTLFRLSNLTRLDISAQQFCWRNIAQFQQFNKIRQFHIQSDAISDEVSGSISDGNDCLIETSDEVSEQETLMEFVAEPTTAFSKSCVMTHEYLAPELISGNGHGSDVDWWGVRSFDLRVIVRKNAVQRSE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G076430`
TK1151 ID	TkA08G076430
OH-1004 ID	LXL04_018650
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	48.500
Protein coverage (%)	TK1151 92.553 / OH-1004 84.936 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G076430

Location Chr08:19630147-19631260 (-)

Description Similar to WAG2: Serine/threonine-protein kinase WAG2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g53700`	Serine/threonine-protein kinase involved in the regulation of auxin signaling.	The WAG1 and WAG2 protein kinases negatively regulate root waving in Arabidopsis.2006 · DOI: 10.1111/j.1365-313x.2005.02641.x NPY genes and AGC kinases define two key steps in auxin-mediated organogenesis in Arabidopsis.2008 · DOI: 10.1073/pnas.0809761106 Plasma membrane-bound AGC3 kinases phosphorylate PIN auxin carriers at TPRXS(N/S) motifs to direct apical PIN recycling.2010 · DOI: 10.1242/dev.052456
`At3g14370`	Serine/threonine-protein kinase involved in the regulation of auxin signaling.	The WAG1 and WAG2 protein kinases negatively regulate root waving in Arabidopsis.2006 · DOI: 10.1111/j.1365-313x.2005.02641.x NPY genes and AGC kinases define two key steps in auxin-mediated organogenesis in Arabidopsis.2008 · DOI: 10.1073/pnas.0809761106 Plasma membrane-bound AGC3 kinases phosphorylate PIN auxin carriers at TPRXS(N/S) motifs to direct apical PIN recycling.2010 · DOI: 10.1242/dev.052456
`At4g26610`	Protein kinase that regulates the auxin transport activity of PIN auxin efflux facilitators by direct phosphorylation.	D6PK AGCVIII kinases are required for auxin transport and phototropic hypocotyl bending in Arabidopsis.2013 · DOI: 10.1105/tpc.113.111484
`At5g55910`	Protein kinase that regulates the auxin transport activity of PIN auxin efflux facilitators by direct phosphorylation.	The polarly localized D6 PROTEIN KINASE is required for efficient auxin transport in Arabidopsis thaliana.2009 · DOI: 10.1242/dev.028365 D6PK AGCVIII kinases are required for auxin transport and phototropic hypocotyl bending in Arabidopsis.2013 · DOI: 10.1105/tpc.113.111484 Arabidopsis D6PK is a lipid domain-dependent mediator of root epidermal planar polarity.2015 · DOI: 10.1038/nplants.2015.162
`At3g27580`	Protein kinase that regulates the auxin transport activity of PIN auxin efflux facilitators by direct phosphorylation.	D6PK AGCVIII kinases are required for auxin transport and phototropic hypocotyl bending in Arabidopsis.2013 · DOI: 10.1105/tpc.113.111484

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018650 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0009638 phototropism Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009926 auxin polar transport Biological Process

GO:0010540 basipetal auxin transport Biological Process

GO:0048825 cotyledon development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G53700

ath:AT2G36350

ath:AT3G14370

ath:AT3G52890

ath:AT5G47750

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.368

Rank 1 · TkA08G076430 · TK1151

Nucleus0.359

Rank 2 · TkA08G076430 · TK1151

Cell membrane0.207

Rank 3 · TkA08G076430 · TK1151

Endoplasmic reticulum0.090

Rank 4 · TkA08G076430 · TK1151

Mitochondrion0.066

Rank 5 · TkA08G076430 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23598LRR_145-100 aa

PF12799LRR_47-30 aa

PF13855LRR_812-53 aa

PF24758LRR_At5g5637015-51 aa

PF00560LRR_118-39 aa

PF29594LRR_SKP232-77 aa

PF24758LRR_At5g5637042-104 aa

PF13855LRR_843-73 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G076430	`PF23598`	LRR_14	5	100	1.3e-05	24.9
TkA08G076430	`PF12799`	LRR_4	7	30	2.2e-05	25.3
TkA08G076430	`PF13855`	LRR_8	12	53	2.7e-06	27.8
TkA08G076430	`PF24758`	LRR_At5g56370	15	51	0.00058	20.3
TkA08G076430	`PF00560`	LRR_1	18	39	1.1e-06	28.2
TkA08G076430	`PF29594`	LRR_SKP2	32	77	0.12	12.3
TkA08G076430	`PF24758`	LRR_At5g56370	42	104	0.00058	20.3
TkA08G076430	`PF13855`	LRR_8	43	73	2.7e-06	27.8
TkA08G076430	`PF00560`	LRR_1	45	63	1.1e-06	28.2
TkA08G076430	`PF12799`	LRR_4	46	74	2.2e-05	25.3
TkA08G076430	`PF00560`	LRR_1	66	85	1.1e-06	28.2
TkA08G076430	`PF00069`	Pkinase	141	170	1.3e-05	25.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C8M5`	Arabidopsis thaliana	sp\|Q9C8M5\|WAG1_ARATH Serine/threonine-protein kinase WAG1	56.700%	Swiss-Prot	Low
`Q9LUL2`	Arabidopsis thaliana	sp\|Q9LUL2\|WAG2_ARATH Serine/threonine-protein kinase WAG2	64.200%	Swiss-Prot	Low
`Q9SUA3`	Arabidopsis thaliana	sp\|Q9SUA3\|D6KL1_ARATH Serine/threonine-protein kinase D6PKL1	54.200%	Swiss-Prot	Low
`Q9FG74`	Arabidopsis thaliana	sp\|Q9FG74\|D6PK_ARATH Serine/threonine-protein kinase D6PK	54.200%	Swiss-Prot	Low
`Q05999`	Arabidopsis thaliana	sp\|Q05999\|D6KL3_ARATH Serine/threonine-protein kinase D6PKL3	61.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card