LXL04_018650 | RubberDandelionOmics

Gene overview

LXL04_018650

Reference: OH-1004 Chr: Chr04 Coordinates: 16316556-16320349 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

939 bp · LXL04_018650|LXL04_018650|OH1004|cDNA

ATGgATACTTGGATATTGCTTTGCATCTCTTTTCGCAGGATCTTTGAAGAGGACCCGTGTTCATGGAAAGGACTCTCCGGACAAAACCCACTAAACACAATCGGGAGCTTGACCCGACTCCGCACGCTCAGCCTCCACAGAAACCTCCTCTCCGGCGTAATCCCGCAAGACCTGGAGTTTTGCTCTGAGCTCGGGATCCTTAACCTGCAAAACAACCGATTATCCGACGAAATCCCTGTGACTCTTTTTAGGCTTTCTAA...

CDS

Download CDS FASTA

939 bp · LXL04_018650|LXL04_018650|OH1004|CDS

ATGGATACTTGGATATTGCTTTGCATCTCTTTTCGCAGGATCTTTGAAGAGGACCCGTGTTCATGGAAAGGACTCTCCGGACAAAACCCACTAAACACAATCGGGAGCTTGACCCGACTCCGCACGCTCAGCCTCCACAGAAACCTCCTCTCCGGCGTAATCCCGCAAGACCTGGAGTTTTGCTCTGAGCTCGGGATCCTTAACCTGCAAAACAACCGATTATCCGACGAAATCCCTGTGACTCTTTTTAGGCTTTCTAA...

Protein

Download Protein FASTA

312 aa · LXL04_018650|LXL04_018650|OH1004|PROTEIN

MDTWILLCISFRRIFEEDPCSWKGLSGQNPLNTIGSLTRLRTLSLHRNLLSGVIPQDLEFCSELGILNLQNNRLSDEIPVTLFRLSNLTRLDISGNNFAGEISPSFSNLTRSGSMAISYSISDEKSKWLFNFRQFHIQSDAISDEVSGSISDGNGCLIETSDEVSGSTYVQWLFNQSVELRKTFWSAKTVTLCCRTFDLCFNADVVPKLDRRTRSRRKTKHSDCFGYYGGRRYTEQETLMEFVAEPTTAFSKSCVMTHEY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018650`
TK1151 ID	TkA08G076430
OH-1004 ID	LXL04_018650
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	48.500
Protein coverage (%)	TK1151 92.553 / OH-1004 84.936 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018650

Location Chr04:16316556-16320349 (-)

Description Similar to WAG2: Serine/threonine-protein kinase WAG2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g14370`	Serine/threonine-protein kinase involved in the regulation of auxin signaling.	The WAG1 and WAG2 protein kinases negatively regulate root waving in Arabidopsis.2006 · DOI: 10.1111/j.1365-313x.2005.02641.x NPY genes and AGC kinases define two key steps in auxin-mediated organogenesis in Arabidopsis.2008 · DOI: 10.1073/pnas.0809761106 Plasma membrane-bound AGC3 kinases phosphorylate PIN auxin carriers at TPRXS(N/S) motifs to direct apical PIN recycling.2010 · DOI: 10.1242/dev.052456
`At1g53700`	Serine/threonine-protein kinase involved in the regulation of auxin signaling.	The WAG1 and WAG2 protein kinases negatively regulate root waving in Arabidopsis.2006 · DOI: 10.1111/j.1365-313x.2005.02641.x NPY genes and AGC kinases define two key steps in auxin-mediated organogenesis in Arabidopsis.2008 · DOI: 10.1073/pnas.0809761106 Plasma membrane-bound AGC3 kinases phosphorylate PIN auxin carriers at TPRXS(N/S) motifs to direct apical PIN recycling.2010 · DOI: 10.1242/dev.052456
`At3g52890`	Could be involved in the negative regulation of root growth.	PERK-KIPK-KCBP signalling negatively regulates root growth in Arabidopsis thaliana.2015 · DOI: 10.1093/jxb/eru390
`At2g36350`	Serine/threonine-protein kinase that could be involved in the negative regulation of root growth.	No verified direct reference in this release
`At5g47750`	Protein kinase that regulates the auxin transport activity of PIN auxin efflux facilitators by direct phosphorylation.	D6PK AGCVIII kinases are required for auxin transport and phototropic hypocotyl bending in Arabidopsis.2013 · DOI: 10.1105/tpc.113.111484

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018650 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0009638 phototropism Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009926 auxin polar transport Biological Process

GO:0010540 basipetal auxin transport Biological Process

GO:0048825 cotyledon development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G53700

ath:AT2G36350

ath:AT3G14370

ath:AT3G52890

ath:AT5G47750

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.385

Rank 1 · LXL04_018650 · OH-1004

Nucleus0.378

Rank 2 · LXL04_018650 · OH-1004

Cell membrane0.153

Rank 3 · LXL04_018650 · OH-1004

Endoplasmic reticulum0.097

Rank 4 · LXL04_018650 · OH-1004

Mitochondrion0.082

Rank 5 · LXL04_018650 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13855.13LRR_839-98 aa

PF12799.14LRR_467-104 aa

PF07714.24PK_Tyr_Ser-Thr250-304 aa

PF00069.32Pkinase251-308 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018650	`PF13855.13`	LRR_8	39	98	3.3e-07	30.7
LXL04_018650	`PF12799.14`	LRR_4	67	104	2.9e-07	31.3
LXL04_018650	`PF07714.24`	PK_Tyr_Ser-Thr	250	304	1.2e-06	28.8
LXL04_018650	`PF00069.32`	Pkinase	251	308	2.3e-14	54.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LUL2`	Arabidopsis thaliana	Serine/threonine-protein kinase WAG2	57.018%	Swiss-Prot	weak database homology
`Q9C8M5`	Arabidopsis thaliana	Serine/threonine-protein kinase WAG1	55.263%	Swiss-Prot	weak database homology
`Q9LFA2`	Arabidopsis thaliana	Serine/threonine-protein kinase KIPK1	47.222%	Swiss-Prot	weak database homology
`Q9SJM3`	Arabidopsis thaliana	Serine/threonine-protein kinase KIPK2	50.485%	Swiss-Prot	weak database homology
`Q39183`	Arabidopsis thaliana	Serine/threonine-protein kinase D6PKL2	69.492%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card