TkA08G075350 | RubberDandelionOmics

Gene overview

TkA08G075350

Reference: TK1151 Chr: Chr08 Coordinates: 19358213-19359940 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1602 bp · TkA08G075350|TK1151|cDNA

ATTCTAGAAGCACATCTCCCATTTGACTATTTTGGTTACCCATCAACACTGTTAAGCAAAGAAAAAGTAAAAACCCTTCTCCAAGTATTTCACCATCCCATATATAAATCAAACGCCAAAATAATCCATCAAACCAAGGGAGAATCTACATACAGGAGAATAAAGCTTCAGACAGCAACAGCCATGGACGACGATAATATCCCATTGTTGGACCTCGAAAAATTGAAGGTTATATCGCCGTTAGGTCGCGGAGCTAAAGG...

CDS

Download CDS FASTA

1383 bp · TkA08G075350|TK1151|CDS

ATTCTAGAAGCACATCTCCCATTTGACTATTTTGGTTACCCATCAACACTGTTAAGCAAAGAAAAAGTAAAAACCCTTCTCCAAGTATTTCACCATCCCATATATAAATCAAACGCCAAAATAATCCATCAAACCAAGGGAGAATCTACATACAGGAGAATAAAGCTTCAGACAGCAACAGCCATGGACGACGATAATATCCCATTGTTGGACCTCGAAAAATTGAAGGTTATATCGCCGTTAGGTCGCGGAGCTAAAGG...

Protein

Download Protein FASTA

460 aa · TkA08G075350|TK1151|PROTEIN

ILEAHLPFDYFGYPSTLLSKEKVKTLLQVFHHPIYKSNAKIIHQTKGESTYRRIKLQTATAMDDDNIPLLDLEKLKVISPLGRGAKGVVFLVQNEASDGELLALKVISRASIKMKVKDKDSDGSEYKRICFEKEVLRRCQHPLLPKLRGVLSTESIVGYAIDYCPGRDLNYLRKQQTEKMFSDDLIRFYAAELVLALEYLHGLGIVYRDLKPENIMIQENGHLMLIDFDLSTKLPPKPHSRSPSPKTTSTPKPDALTKKK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G075350`
TK1151 ID	TkA08G075350
OH-1004 ID	LXL04_036731
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	72.900
Protein coverage (%)	TK1151 83.261 / OH-1004 96.962 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G075350

Location Chr08:19358213-19359940 (-)

Description Similar to OXI1: Serine/threonine-protein kinase OXI1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g25250`	Involved in oxidative burst-mediated signaling.	OXI1 kinase is necessary for oxidative burst-mediated signalling in Arabidopsis.2004 · DOI: 10.1038/nature02353 The Arabidopsis protein kinase Pto-interacting 1-4 is a common target of the oxidative signal-inducible 1 and mitogen-activated protein kinases.2011 · DOI: 10.1111/j.1742-4658.2011.08033.x
`At1g51170`	Regulates planar ovule integument development by suppressing aberrantly oriented growth.	No verified direct reference in this release
`At3g20830`	Regulates planar ovule integument development.	No verified direct reference in this release
`At5g58140`	Protein kinase that acts as a blue light photoreceptor in a signal-transduction pathway for photo-induced movements.	Arabidopsis NPL1: a phototropin homolog controlling the chloroplast high-light avoidance response.2001 · DOI: 10.1126/science.291.5511.2138 Arabidopsis nph1 and npl1: blue light receptors that mediate both phototropism and chloroplast relocation.2001 · DOI: 10.1073/pnas.101137598 Phot1 and phot2 mediate blue light-induced transient increases in cytosolic Ca2+ differently in Arabidopsis leaves.2003 · DOI: 10.1073/pnas.1336802100 A transgene encoding a blue-light receptor, phot1, restores blue-light responses in the Arabidopsis phot1 phot2 double mutant.2004 · DOI: 10.1093/jxb/erh044 Functional analysis of each blue light receptor, cry1, cry2, phot1, and phot2, by using combinatorial multiple mutants in Arabidopsis.2004 · DOI: 10.1073/pnas.0305984101 RPT2 is a signal transducer involved in phototropic response and stomatal opening by association with phototropin 1 in Arabidopsis thaliana.2004 · DOI: 10.1105/tpc.019901 Biochemical characterization of plasma membrane H+-ATPase activation in guard cell protoplasts of Arabidopsis thaliana in response to blue light.2005 · DOI: 10.1093/pcp/pci104 An ATP-Binding Cassette Transporter, ABCB19, Regulates Leaf Position and Morphology during Phototropin1-Mediated Blue Light Responses.2020 · DOI: 10.1104/pp.20.00223

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0304200`	Protein kinase that acts as a blue light photoreceptor in a signal-transduction pathway for phototropic responses.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036731 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0006952 defense response Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009611 response to wounding Biological Process

GO:0036290 protein trans-autophosphorylation Biological Process

GO:0042542 response to hydrogen peroxide Biological Process

GO:0051782 negative regulation of cell division Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0080060 integument development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G51170

ath:AT3G20830

ath:AT3G25250

dosa:Os06g0291600

osa:4340792

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.525

Rank 1 · TkA08G075350 · TK1151

Nucleus0.507

Rank 2 · TkA08G075350 · TK1151

Mitochondrion0.058

Rank 3 · TkA08G075350 · TK1151

Cell membrane0.055

Rank 4 · TkA08G075350 · TK1151

Endoplasmic reticulum0.033

Rank 5 · TkA08G075350 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10707YrbL-PhoP_reg29-56 aa

PF06293Kdo62-76 aa

PF13095FTA273-116 aa

PF14531Kinase-like75-111 aa

PF07714PK_Tyr_Ser-Thr76-238 aa

PF00069Pkinase77-239 aa

PF10707YrbL-PhoP_reg79-221 aa

PF18362THB120-132 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G075350	`PF10707`	YrbL-PhoP_reg	29	56	0.002	18.5
TkA08G075350	`PF06293`	Kdo	62	76	0.035	14.3
TkA08G075350	`PF13095`	FTA2	73	116	0.043	14.2
TkA08G075350	`PF14531`	Kinase-like	75	111	0.00023	21.3
TkA08G075350	`PF07714`	PK_Tyr_Ser-Thr	76	238	4.4e-24	85.9
TkA08G075350	`PF00069`	Pkinase	77	239	2.8e-55	188.3
TkA08G075350	`PF10707`	YrbL-PhoP_reg	79	221	0.002	18.5
TkA08G075350	`PF18362`	THB	120	132	0.23	11.8
TkA08G075350	`PF03109`	ABC1	160	237	0.0039	17.1
TkA08G075350	`PF06293`	Kdo	182	232	0.035	14.3
TkA08G075350	`PF13095`	FTA2	191	222	0.043	14.2
TkA08G075350	`PF14531`	Kinase-like	193	229	0.00023	21.3
TkA08G075350	`PF17667`	Pkinase_fungal	196	241	0.0015	18.1
TkA08G075350	`PF01636`	APH	201	232	0.0052	17.3
TkA08G075350	`PF00454`	PI3_PI4_kinase	212	232	0.16	12.6
TkA08G075350	`PF00069`	Pkinase	298	396	2.8e-55	188.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LSF1`	Arabidopsis thaliana	sp\|Q9LSF1\|OXI1_ARATH Serine/threonine-protein kinase OXI1	61.600%	Swiss-Prot	High
`Q9SYB9`	Arabidopsis thaliana	sp\|Q9SYB9\|UNC_ARATH Serine/threonine-protein kinase UCN	44.700%	Swiss-Prot	Medium
`Q9LT38`	Arabidopsis thaliana	sp\|Q9LT38\|UNCL_ARATH Serine/threonine-protein kinase UCNL	44.200%	Swiss-Prot	Medium
`P93025`	Arabidopsis thaliana	sp\|P93025\|PHOT2_ARATH Phototropin-2	40.300%	Swiss-Prot	Medium
`Q9ST27`	Oryza sativa subsp. japonica	sp\|Q9ST27\|PHOT2_ORYSJ Phototropin-2	39.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card