TkA08G072490 | RubberDandelionOmics

Gene overview

TkA08G072490

Reference: TK1151 Chr: Chr08 Coordinates: 18704418-18708937 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2111 bp · TkA08G072490|TK1151|cDNA

TTGTTTATGTAGAAACTATTTGATCAGTACTACTAATAGCCCATAATAAATCGTCACTTCTGAGGAAAGTCTAAGCCCAAGCCCAGATCTCACACGTGCCATGAGAACACTTCCCACGAGTAAACACCAATCTGCCCTCCGCTCTCGGTTCTCAAACCCCCAAATTCGCCCCCTTACCAGTTTCCCCAGTCTTTTGCTTCTGCAGCTCCCTTCGAGACAAAGATAAACGACACCATTTTCTCCGATTCTTCATAAGGTAT...

CDS

Download CDS FASTA

1512 bp · TkA08G072490|TK1151|CDS

ATGTATCGCGCCGCTGCATCGAAAATCAGAATCGCCAAGGGCCATGGGGGCAACAGGACCCTTGCCAGGTTTGCAAGCTCAAGTGCAGTTGCTGCCAAATCATCATCAGGAGGTATCTTCAGCTGGTTTACAGGAGGAAGTTCTTCAAGTCTCCCACCTCTAGACTTTCCACTCAAAGGCATTGAACTTCCATCTTCTTTACCTGACCACGTTGAAACCGGAAAAACCAAAATCACAACCCTCCCAAATGGAGTCAGAAT...

Protein

Download Protein FASTA

503 aa · TkA08G072490|TK1151|PROTEIN

MYRAAASKIRIAKGHGGNRTLARFASSSAVAAKSSSGGIFSWFTGGSSSSLPPLDFPLKGIELPSSLPDHVETGKTKITTLPNGVRIASETSPNPAASIGLYVNSGSMYETPVSFGSTHLLERMAFKSTANRSHLRVVREVEAIGGNVTASASREQMGYTYDALKTYVPQMVELLVDCARNQVFLDWEVKEQIEKVKAEISEYANNPETLLLEAIHSAGYSGALANPLLASEGSLNRLNSSILEDFVAENYTASRIVLAA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G072490`
TK1151 ID	TkA08G072490
OH-1004 ID	LXL04_018623
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 97.614 / OH-1004 87.211 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G072490

Location Chr08:18704418-18708937 (-)

Description Similar to MPP: Mitochondrial-processing peptidase subunit alpha

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g16480`	Substrate recognition and binding subunit of the essential mitochondrial processing protease (MPP), which cleaves the mitochondrial sequence off newly imported precursors proteins.	No verified direct reference in this release
`At1g51980`	Substrate recognition and binding subunit of the essential mitochondrial processing protease (MPP), which cleaves the mitochondrial sequence off newly imported precursors proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018623 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0006627 protein processing involved in protein targeting to mitochondrion Biological Process

GO:0022904 respiratory electron transport chain Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005741 mitochondrial outer membrane Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005758 mitochondrial intermembrane space Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G51980

ath:AT3G16480

sce:YHR024C

sot:102580877

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.908

Rank 1 · TkA08G072490 · TK1151

Cytoplasm0.066

Rank 2 · TkA08G072490 · TK1151

Plastid0.048

Rank 3 · TkA08G072490 · TK1151

Nucleus0.039

Rank 4 · TkA08G072490 · TK1151

Cell membrane0.014

Rank 5 · TkA08G072490 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00675Peptidase_M1686-230 aa

PF05193Peptidase_M16_C243-422 aa

PF00675Peptidase_M16404-446 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G072490	`PF00675`	Peptidase_M16	86	230	6.2e-41	140.5
TkA08G072490	`PF05193`	Peptidase_M16_C	243	422	5.9e-31	108.5
TkA08G072490	`PF00675`	Peptidase_M16	404	446	6.2e-41	140.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O04308`	Arabidopsis thaliana	sp\|O04308\|MPPA2_ARATH Probable mitochondrial-processing peptidase subunit alpha-2, chloroplastic/mitochondrial	65.300%	Swiss-Prot	High
`Q9ZU25`	Arabidopsis thaliana	sp\|Q9ZU25\|MPPA1_ARATH Probable mitochondrial-processing peptidase subunit alpha-1, mitochondrial	65.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card