LXL04_018623 | RubberDandelionOmics

Gene overview

LXL04_018623

Reference: OH-1004 Chr: Chr04 Coordinates: 15715114-15719267 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1692 bp · LXL04_018623|LXL04_018623|OH1004|cDNA

ATGTTCACCTCTCAGGAAACTCTAAGCCCAAGCCCAATCCCAAGCCCAGATCTCACACGTGCCATGAGAACACTTCCCACGAGTAAACACCAATCTGCCCTCCGCTCTCGGTTCTCAAACCCCCAAATTCGCCCCCTTACCAGTTTCCCCAGTCTTTTGCTTCTGCAGCTCCCTTCGAGACAAAGACAAACGACACCATATTCTCCGATTCTTCATAAGGGCCATGGGGGCAACAGGACCCTTGCCAGGTTTGCAAGCTC...

CDS

Download CDS FASTA

1692 bp · LXL04_018623|LXL04_018623|OH1004|CDS

ATGTTCACCTCTCAGGAAACTCTAAGCCCAAGCCCAATCCCAAGCCCAGATCTCACACGTGCCATGAGAACACTTCCCACGAGTAAACACCAATCTGCCCTCCGCTCTCGGTTCTCAAACCCCCAAATTCGCCCCCTTACCAGTTTCCCCAGTCTTTTGCTTCTGCAGCTCCCTTCGAGACAAAGACAAACGACACCATATTCTCCGATTCTTCATAAGGGCCATGGGGGCAACAGGACCCTTGCCAGGTTTGCAAGCTC...

Protein

Download Protein FASTA

563 aa · LXL04_018623|LXL04_018623|OH1004|PROTEIN

MFTSQETLSPSPIPSPDLTRAMRTLPTSKHQSALRSRFSNPQIRPLTSFPSLLLLQLPSRQRQTTPYSPILHKGHGGNRTLARFASSSAVAAKSSSGGIFSWFTGGSSSSLPPLDFPLKGIELPSSLPDHVETGKTKITTLPNGVRIASETSPNPAASIGLYVNSGSMYETPVSFGSTHLLERMAFKSTANRSHLRVVREVEAIGGNVTASASREQMGYTYDALKTYVPQMVELLVDCARNQVFLDWEVKEQIEKVKAEI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018623`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018623

Location Chr04:15715114-15719267 (-)

Description Similar to MPP: Mitochondrial-processing peptidase subunit alpha

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g51980`	Substrate recognition and binding subunit of the essential mitochondrial processing protease (MPP), which cleaves the mitochondrial sequence off newly imported precursors proteins.	No verified direct reference in this release
`At3g16480`	Substrate recognition and binding subunit of the essential mitochondrial processing protease (MPP), which cleaves the mitochondrial sequence off newly imported precursors proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018623 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0006627 protein processing involved in protein targeting to mitochondrion Biological Process

GO:0022904 respiratory electron transport chain Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005741 mitochondrial outer membrane Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005758 mitochondrial intermembrane space Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G51980

ath:AT3G16480

sce:YHR024C

sot:102580877

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.871

Rank 1 · LXL04_018623 · OH-1004

Plastid0.105

Rank 2 · LXL04_018623 · OH-1004

Cytoplasm0.059

Rank 3 · LXL04_018623 · OH-1004

Nucleus0.034

Rank 4 · LXL04_018623 · OH-1004

Extracellular0.014

Rank 5 · LXL04_018623 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00675.26Peptidase_M16146-290 aa

PF05193.27Peptidase_M16_C303-482 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018623	`PF00675.26`	Peptidase_M16	146	290	8.1e-41	140.1
LXL04_018623	`PF05193.27`	Peptidase_M16_C	303	482	7.5e-31	108.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZU25`	Arabidopsis thaliana	Probable mitochondrial-processing peptidase subunit alpha-1, mitochondrial	65.631%	Swiss-Prot	strong database homology
`O04308`	Arabidopsis thaliana	Probable mitochondrial-processing peptidase subunit alpha-2, chloroplastic/mitochondrial	66.814%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card