TkA08G066500 | RubberDandelionOmics

Gene overview

TkA08G066500

Reference: TK1151 Chr: Chr08 Coordinates: 17104887-17110204 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1045 bp · TkA08G066500|TK1151|cDNA

CTATCAATCGACCCACCCCTATACCCACACCTCCAACATTGACTCCAATACATAAATCAACAAACCAAATCCCCTTTGCCCAACCCTTGCACAAAATAATTACCGGTTTCTTAATCAAACCCTCGTCAATTTAACAACTTACCACCATCGAATAATGGGTTGGAGCACGTTAGTAATCGTATTAGTAGCAACAACAGTGACATTTACATCGGCGAGGAGAGGAGGGAATCCCGATGTGGCCGCACTTTCCGCCTTTCGCA...

CDS

Download CDS FASTA

648 bp · TkA08G066500|TK1151|CDS

ATGGGTTGGAGCACGTTAGTAATCGTATTAGTAGCAACAACAGTGACATTTACATCGGCGAGGAGAGGAGGGAATCCCGATGTGGCCGCACTTTCCGCCTTTCGCAAGGCCGTAAAGGATCCCAGTAAAGTACTTGAGACTTGGGATTCTGGTCTTACTGATGCATGTACCTGGATTCACATCAAATGCAGCCCAGATAACCACGTTATCCGTGTGGATCTTGGAAACTCAAACTTGACGGGCTATCTCCCAACTGAACT...

Protein

Download Protein FASTA

215 aa · TkA08G066500|TK1151|PROTEIN

MGWSTLVIVLVATTVTFTSARRGGNPDVAALSAFRKAVKDPSKVLETWDSGLTDACTWIHIKCSPDNHVIRVDLGNSNLTGYLPTELGSLEHLQYLELYKNKLQGIIPKELGNLKSLVSLDLYENNLSGSIPASLGNLKALIFLRLNNNQLSGRIPRELKGATNLKVVDVSHNNLCGTFPTTGPFAHIPLSNFENNPRLEGPELMGLASYDTNCT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G066500`
TK1151 ID	TkA08G066500
OH-1004 ID	LXL04_018526
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	70.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G066500

Location Chr08:17104887-17110204 (+)

Description Similar to LRR1: Leucine-rich repeat protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g21090`	Involved in plant defense response.	A novel simple extracellular leucine-rich repeat (eLRR) domain protein from rice (OsLRR1) enters the endosomal pathway and interacts with the hypersensitive-induced reaction protein 1 (OsHIR1).2009 · DOI: 10.1111/j.1365-3040.2009.02039.x
`At3g43740`	Probably involved in plant defense response.	No verified direct reference in this release
`At4g33430`	Dual specificity kinase acting on both serine/threonine- and tyrosine-containing substrates.	The BRI1-associated kinase 1, BAK1, has a brassinolide-independent role in plant cell-death control.2007 · DOI: 10.1016/j.cub.2007.05.046 BAK1 and BKK1 regulate brassinosteroid-dependent growth and brassinosteroid-independent cell-death pathways.2007 · DOI: 10.1016/j.cub.2007.05.036 Arabidopsis SOMATIC EMBRYOGENESIS RECEPTOR KINASE proteins serve brassinosteroid-dependent and -independent signaling pathways.2008 · DOI: 10.1104/pp.108.123216 Tyrosine phosphorylation of the BRI1 receptor kinase emerges as a component of brassinosteroid signaling in Arabidopsis.2009 · DOI: 10.1073/pnas.0810249106 Phosphorylation of receptor-like cytoplasmic kinases by bacterial flagellin.2010 · DOI: 10.4161/psb.11500 The Arabidopsis leucine-rich repeat receptor-like kinases BAK1/SERK3 and BKK1/SERK4 are required for innate immunity to hemibiotrophic and biotrophic pathogens.2011 · DOI: 10.1105/tpc.111.084301 Structure of the pseudokinase domain of BIR2, a regulator of BAK1-mediated immune signaling in Arabidopsis.2014 · DOI: 10.1016/j.jsb.2014.02.005 Phytosulfokine Regulates Growth in Arabidopsis through a Response Module at the Plasma Membrane That Includes CYCLIC NUCLEOTIDE-GATED CHANNEL17, H+-ATPase, and BAK1.2015 · DOI: 10.1105/tpc.15.00306 An RLP23-SOBIR1-BAK1 complex mediates NLP-triggered immunity.2015 · DOI: 10.1038/nplants.2015.140 The SCOOP12 peptide regulates defense response and root elongation in Arabidopsis thaliana.2019 · DOI: 10.1093/jxb/ery454 The Arabidopsis MIK2 receptor elicits immunity by sensing a conserved signature from phytocytokines and microbes.2021 · DOI: 10.1038/s41467-021-25580-w

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8ABC2`	Involved in plant defense response.	No verified direct reference in this release
`Os01g0809300`	Involved in plant defense response.	A novel simple extracellular leucine-rich repeat (eLRR) domain protein from rice (OsLRR1) enters the endosomal pathway and interacts with the hypersensitive-induced reaction protein 1 (OsHIR1).2009 · DOI: 10.1111/j.1365-3040.2009.02039.x
`Os04g0457800`	LRR receptor kinase involved in positive regulation of somatic embryogenesis and defense response against the rice blast fungus pathogen Magnaporthe oryzae.	Rice SERK1 gene positively regulates somatic embryogenesis of cultured cell and host defense response against fungal infection.2005 · DOI: 10.1007/s00425-005-1534-4 An XA21-associated kinase (OsSERK2) regulates immunity mediated by the XA21 and XA3 immune receptors.2014 · DOI: 10.1093/mp/ssu003

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018526 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0031901 early endosome membrane Cellular Component

GO:0031902 late endosome membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004675 transmembrane receptor protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0015026 coreceptor activity Molecular Function

KEGG gene cross-reference

ath:AT3G43740

ath:AT5G21090

dosa:Os01g0809300

dosa:Os08g0174700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.546

Rank 1 · TkA08G066500 · TK1151

Extracellular0.162

Rank 2 · TkA08G066500 · TK1151

Endoplasmic reticulum0.112

Rank 3 · TkA08G066500 · TK1151

Cytoplasm0.086

Rank 4 · TkA08G066500 · TK1151

Lysosome / Vacuole0.048

Rank 5 · TkA08G066500 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263LRRNT_225-64 aa

PF00560LRR_171-90 aa

PF23598LRR_1471-169 aa

PF13855LRR_871-127 aa

PF12799LRR_471-103 aa

PF23211LRR_LRWD172-104 aa

PF24141LRR_ComC72-110 aa

PF00560LRR_192-114 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G066500	`PF08263`	LRRNT_2	25	64	2.9e-09	37.7
TkA08G066500	`PF00560`	LRR_1	71	90	2.2e-17	60.1
TkA08G066500	`PF23598`	LRR_14	71	169	5.7e-12	45.8
TkA08G066500	`PF13855`	LRR_8	71	127	2.3e-11	44.0
TkA08G066500	`PF12799`	LRR_4	71	103	2.7e-11	44.1
TkA08G066500	`PF23211`	LRR_LRWD1	72	104	0.00035	21.1
TkA08G066500	`PF24141`	LRR_ComC	72	110	0.044	14.2
TkA08G066500	`PF00560`	LRR_1	92	114	2.2e-17	60.1
TkA08G066500	`PF12799`	LRR_4	92	132	2.7e-11	44.1
TkA08G066500	`PF23211`	LRR_LRWD1	93	152	0.00035	21.1
TkA08G066500	`PF29252`	LRR_NLRC4	112	142	0.088	12.7
TkA08G066500	`PF29252`	LRR_NLRC4	113	166	0.088	12.7
TkA08G066500	`PF00560`	LRR_1	116	138	2.2e-17	60.1
TkA08G066500	`PF13855`	LRR_8	125	175	2.3e-11	44.0
TkA08G066500	`PF24141`	LRR_ComC	131	178	0.044	14.2
TkA08G066500	`PF12799`	LRR_4	140	178	2.7e-11	44.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FPJ5`	Arabidopsis thaliana	sp\|Q9FPJ5\|LRR1_ARATH Leucine-rich repeat protein 1	84.800%	Swiss-Prot	High
`Q6NQP4`	Arabidopsis thaliana	sp\|Q6NQP4\|LRR2_ARATH Leucine-rich repeat protein 2	80.900%	Swiss-Prot	High
`Q94F62`	Arabidopsis thaliana	sp\|Q94F62\|BAK1_ARATH BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1	69.300%	Swiss-Prot	Low
`B8ABC2`	Oryza sativa subsp. indica	sp\|B8ABC2\|LRR1_ORYSI Leucine-rich repeat protein 1	79.500%	Swiss-Prot	High
`Q5VQP7`	Oryza sativa subsp. japonica	sp\|Q5VQP7\|LRR1_ORYSJ Leucine-rich repeat protein 1	79.500%	Swiss-Prot	High
`Q7XV05`	Oryza sativa subsp. japonica	sp\|Q7XV05\|SERK2_ORYSJ LRR receptor kinase SERK2	50.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card