RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_018526
Reference: OH-1004 Chr: Chr04 Coordinates: 14271801-14276729 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

840 bp · LXL04_018526|LXL04_018526|OH1004|cDNA

ATGGGTTGGAGCACGTTAGTAATCGTATTAGTAGCAACAACAGTGACATTTACATCGGCGAGGAGAGGAGGGAATCCCGATGTGGCCGCACTTTCCGCCTTTCGCAAGGCCGTAAAGGATCCCAGTAAAGTACTTGAGACTTGGGATTCTGGTCTTACTGATGCATGTACCTGGATTCACATCAAATGCAGCCCAGATAACCACGTTATCCGTGTTTGGAGCACGTTAGTAATCGTATTAGCGGCGGCGTTTACATCGAC...

CDS

Download CDS FASTA

840 bp · LXL04_018526|LXL04_018526|OH1004|CDS

ATGGGTTGGAGCACGTTAGTAATCGTATTAGTAGCAACAACAGTGACATTTACATCGGCGAGGAGAGGAGGGAATCCCGATGTGGCCGCACTTTCCGCCTTTCGCAAGGCCGTAAAGGATCCCAGTAAAGTACTTGAGACTTGGGATTCTGGTCTTACTGATGCATGTACCTGGATTCACATCAAATGCAGCCCAGATAACCACGTTATCCGTGTTTGGAGCACGTTAGTAATCGTATTAGCGGCGGCGTTTACATCGAC...

Protein

Download Protein FASTA

279 aa · LXL04_018526|LXL04_018526|OH1004|PROTEIN

MGWSTLVIVLVATTVTFTSARRGGNPDVAALSAFRKAVKDPSKVLETWDSGLTDACTWIHIKCSPDNHVIRVWSTLVIVLAAAFTSTVSGNSEGDALYALRRSLSDPDNILQSWDPNLVSPCTWFHITCNQDNHVTRVDLGNSNLTGYLPTELGSLEHLQELYKNKLQGIIPKELGNLKSLVSLDLYENNLSGSIPASLGNLKALIFLRLNNNQLSGRIPRELKGATNLKVVDVSHNNLCGTFPTTGPFAHIPLSNFENN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_018526
TK1151 IDTkA08G066500
OH-1004 IDLXL04_018526
Relationship / confidenceRbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)70.800
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_018526
LocationChr04:14271801-14276729 (+)
DescriptionSimilar to LRR1: Leucine-rich repeat protein 1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g21090 Involved in plant defense response.
A novel simple extracellular leucine-rich repeat (eLRR) domain protein from rice (OsLRR1) enters the endosomal pathway and interacts with the hypersensitive-induced reaction protein 1 (OsHIR1).2009 · DOI: 10.1111/j.1365-3040.2009.02039.x
At3g43740 Probably involved in plant defense response. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os01g0809300 Involved in plant defense response.
A novel simple extracellular leucine-rich repeat (eLRR) domain protein from rice (OsLRR1) enters the endosomal pathway and interacts with the hypersensitive-induced reaction protein 1 (OsHIR1).2009 · DOI: 10.1111/j.1365-3040.2009.02039.x
UniProt: B8ABC2 Involved in plant defense response. No verified direct reference in this release
Os08g0174700 LRR receptor kinase involved in defense response.
Engineering OsBAK1 gene as a molecular tool to improve rice architecture for high yield.2009 · DOI: 10.1111/j.1467-7652.2009.00444.x
A subset of OsSERK genes, including OsBAK1, affects normal growth and leaf development of rice.2011 · DOI: 10.1007/s10059-011-0178-4
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_018526 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0006952 defense response Biological Process
GO:0007165 signal transduction Biological Process
GO:0009742 brassinosteroid mediated signaling pathway Biological Process
GO:0005576 extracellular region Cellular Component
GO:0005739 mitochondrion Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0031901 early endosome membrane Cellular Component
GO:0031902 late endosome membrane Cellular Component
GO:0004672 protein kinase activity Molecular Function
GO:0004675 transmembrane receptor protein serine/threonine kinase activity Molecular Function
GO:0005524 ATP binding Molecular Function
GO:0015026 coreceptor activity Molecular Function
KEGG gene cross-reference
ath:AT3G43740
ath:AT5G21090
dosa:Os01g0809300
dosa:Os08g0174700
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.364
Rank 1 · LXL04_018526 · OH-1004
Extracellular0.297
Rank 2 · LXL04_018526 · OH-1004
Endoplasmic reticulum0.119
Rank 3 · LXL04_018526 · OH-1004
Cytoplasm0.102
Rank 4 · LXL04_018526 · OH-1004
Lysosome / Vacuole0.073
Rank 5 · LXL04_018526 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_225-64 aa
PF08263.18LRRNT_291-130 aa
PF23598.2LRR_14144-233 aa
PF13855.13LRR_8164-215 aa
PF12799.14LRR_4204-242 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_018526PF08263.18LRRNT_225642.9e-2279.4
LXL04_018526PF08263.18LRRNT_2911302.9e-2279.4
LXL04_018526PF23598.2LRR_141442331e-0731.8
LXL04_018526PF13855.13LRR_81642151.1e-0835.4
LXL04_018526PF12799.14LRR_42042429.5e-1039.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9FPJ5Arabidopsis thalianaLeucine-rich repeat protein 173.529%Swiss-Protstrong database homology
Q6NQP4Arabidopsis thalianaLeucine-rich repeat protein 271.078%Swiss-Protstrong database homology
Q5VQP7Oryza sativa subsp. japonicaLeucine-rich repeat protein 172.632%Swiss-Protmoderate database homology
B8ABC2Oryza sativa subsp. indicaLeucine-rich repeat protein 172.632%Swiss-Protmoderate database homology
Q6Z4U4Oryza sativa subsp. japonicaLRR receptor kinase BAK157.214%Swiss-Protstrong database homology

JBrowse

View in Genome Browser