TkA08G065530 | RubberDandelionOmics

Gene overview

TkA08G065530

Reference: TK1151 Chr: Chr08 Coordinates: 16797932-16800856 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

684 bp · TkA08G065530|TK1151|cDNA

ATGATGAAGGTACAAGAACACGAGCATCCACTAAAGCTCATTGATTTGCAACATGAAGAAGAAGAAGAAGAGGAAGAAGATGATGACGACGATGATGATGATGATGGTCATGGTCGTGGTGATCTAACTACGGAAGAGGACTTTCAATCATGTACATGTGGCAGGTGTAGCGAACTAATTACCATGTACCATAGGTACTACTACAAATGTATCGATTCATGTTATTACTCACTTCACAAATTCTGTGGTGAGCTCTCAAC...

CDS

Download CDS FASTA

684 bp · TkA08G065530|TK1151|CDS

ATGATGAAGGTACAAGAACACGAGCATCCACTAAAGCTCATTGATTTGCAACATGAAGAAGAAGAAGAAGAGGAAGAAGATGATGACGACGATGATGATGATGATGGTCATGGTCGTGGTGATCTAACTACGGAAGAGGACTTTCAATCATGTACATGTGGCAGGTGTAGCGAACTAATTACCATGTACCATAGGTACTACTACAAATGTATCGATTCATGTTATTACTCACTTCACAAATTCTGTGGTGAGCTCTCAAC...

Protein

Download Protein FASTA

227 aa · TkA08G065530|TK1151|PROTEIN

MMKVQEHEHPLKLIDLQHEEEEEEEEDDDDDDDDDGHGRGDLTTEEDFQSCTCGRCSELITMYHRYYYKCIDSCYYSLHKFCGELSTRLVHPSHPHPLTLWSLKYGVWRCGVCRDSHMSYETCYGCSSCNFYLDMRCAVEAIKKIIHHPCHGHSLMCAIREPILCKCGACGKRHEGIFYQCPTSLIFTIHKDCAFLPKKLLIQQATHNAFDHPHALTISYSFPPEDQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G065530`
TK1151 ID	TkA08G065530
OH-1004 ID	LXL04_002241
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	32.400
Protein coverage (%)	TK1151 45.815 / OH-1004 27.882 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G065530`
Location	Chr08:16797932-16800856 (-)
Description	Similar to At1g60420: Probable nucleoredoxin 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_002241` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0002237 response to molecule of bacterial origin Biological Process GO:0002238 response to molecule of fungal origin Biological Process GO:0002240 response to molecule of oomycetes origin Biological Process GO:0009561 megagametogenesis Biological Process GO:0009617 response to bacterium Biological Process GO:0009860 pollen tube growth Biological Process GO:0010183 pollen tube guidance Biological Process GO:0055046 microgametogenesis Biological Process GO:0080092 regulation of pollen tube growth Biological Process GO:0005634 nucleus Cellular Component GO:0005771 multivesicular body Cellular Component GO:0005829 cytosol Cellular Component
KEGG gene cross-reference	ath:AT1G60420 ath:AT2G17740 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.565

Rank 1 · TkA08G065530 · TK1151

Nucleus0.388

Rank 2 · TkA08G065530 · TK1151

Endoplasmic reticulum0.109

Rank 3 · TkA08G065530 · TK1151

Cell membrane0.075

Rank 4 · TkA08G065530 · TK1151

Extracellular0.070

Rank 5 · TkA08G065530 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03107C1_26-19 aa

PF23048SH3-A_UBE2O13-47 aa

PF15017WRNPLPNID18-36 aa

PF11595DUF324518-42 aa

PF03107C1_246-82 aa

PF03107C1_292-138 aa

PF03107C1_2150-194 aa

PF03107C1_2211-219 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G065530	`PF03107`	C1_2	6	19	1.2e-14	55.1
TkA08G065530	`PF23048`	SH3-A_UBE2O	13	47	0.0016	19.8
TkA08G065530	`PF15017`	WRNPLPNID	18	36	0.67	11.6
TkA08G065530	`PF11595`	DUF3245	18	42	2.9	9.1
TkA08G065530	`PF03107`	C1_2	46	82	1.2e-14	55.1
TkA08G065530	`PF03107`	C1_2	92	138	1.2e-14	55.1
TkA08G065530	`PF03107`	C1_2	150	194	1.2e-14	55.1
TkA08G065530	`PF03107`	C1_2	211	219	1.2e-14	55.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card