Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1122 bp · LXL04_002241|LXL04_002241|OH1004|cDNA
ATGGGGAAGCTGATGCACAGGACCCAAATCCAGCACTCATCTCACCCGCATCTCCTACAACTATCATCATCCCATCATCTTCACAACCACCCTTCCGCCACCTGTGCCGGCTGCAACCACCAATTCTCTCCGGCAGAACACATCTACACCTGCACACCCTGCAACTTCTTCATCCATACCTCATGCTCCAAGTTTCCTGAGTTAATCACACACCCCGCCCATCCCAACCACTCCCTCTCCCTCCTCACCGCCCCCATCTA...
1122 bp · LXL04_002241|LXL04_002241|OH1004|CDS
ATGGGGAAGCTGATGCACAGGACCCAAATCCAGCACTCATCTCACCCGCATCTCCTACAACTATCATCATCCCATCATCTTCACAACCACCCTTCCGCCACCTGTGCCGGCTGCAACCACCAATTCTCTCCGGCAGAACACATCTACACCTGCACACCCTGCAACTTCTTCATCCATACCTCATGCTCCAAGTTTCCTGAGTTAATCACACACCCCGCCCATCCCAACCACTCCCTCTCCCTCCTCACCGCCCCCATCTA...
Protein
Download Protein FASTA373 aa · LXL04_002241|LXL04_002241|OH1004|PROTEIN
MGKLMHRTQIQHSSHPHLLQLSSSHHLHNHPSATCAGCNHQFSPAEHIYTCTPCNFFIHTSCSKFPELITHPAHPNHSLSLLTAPIYPGGFFSCDACAQHGTRFSYHCHTCDFDLHVLCASSPLRVTHPNHPHPLGLTFASPYGEKSGFSCDVCRRIGSGGQWLYRCVPCEFDVHLHCATAKAPSPPPALQHHHSLPAGGAPVAGQALSHSMSAGHVQSQWQPPQTSVPGSIQSYQRPTQSPAPVGGQFYQSPGQPPVPI...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_002241 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_002241 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:44514827-44515948 (-) | |||||||||
| Description | Similar to At1g60420: Probable nucleoredoxin 1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0002237 response to molecule of bacterial origin Biological Process GO:0002238 response to molecule of fungal origin Biological Process GO:0002240 response to molecule of oomycetes origin Biological Process GO:0009561 megagametogenesis Biological Process GO:0009617 response to bacterium Biological Process GO:0009860 pollen tube growth Biological Process GO:0010183 pollen tube guidance Biological Process GO:0055046 microgametogenesis Biological Process GO:0080092 regulation of pollen tube growth Biological Process GO:0005634 nucleus Cellular Component GO:0005771 multivesicular body Cellular Component GO:0005829 cytosol Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT1G60420 ath:AT2G17740 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF03107.23C1_214-62 aaPF03107.23C1_273-120 aaPF03107.23C1_2130-179 aaPF26235.1zf-KKT2_KKT3140-181 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_002241 | PF03107.23 | C1_2 | 14 | 62 | 3.1e-29 | 101.8 |
| LXL04_002241 | PF03107.23 | C1_2 | 73 | 120 | 3.1e-29 | 101.8 |
| LXL04_002241 | PF03107.23 | C1_2 | 130 | 179 | 3.1e-29 | 101.8 |
| LXL04_002241 | PF26235.1 | zf-KKT2_KKT3 | 140 | 181 | 3.6e-07 | 30.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.