TkA08G061640 | RubberDandelionOmics

Gene overview

TkA08G061640

Reference: TK1151 Chr: Chr08 Coordinates: 15772567-15772953 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

387 bp · TkA08G061640|TK1151|cDNA

TTGGAACCGGTTGCCTCAGTGGATTTCTCGTACAATAATCTCTCTGGCTTGGTTCCGGGAACTGATCAGTTCAGCTACTTCAATTACATCTCGTTTTTGGCTAATCCGGATCTTTGCGGCCCCTATCTAGGACCCTGTAAAGACGGCATGGAGGTGTCGGGATCGTCGGAAAAGGAGGTGACGGGATCGTCTACAAAGGCGTCATGCCAAACAACGAGCACGTGGAGGTCCGCCCATGACCATGGATTCAATGCCGAGAT...

CDS

Download CDS FASTA

387 bp · TkA08G061640|TK1151|CDS

TTGGAACCGGTTGCCTCAGTGGATTTCTCGTACAATAATCTCTCTGGCTTGGTTCCGGGAACTGATCAGTTCAGCTACTTCAATTACATCTCGTTTTTGGCTAATCCGGATCTTTGCGGCCCCTATCTAGGACCCTGTAAAGACGGCATGGAGGTGTCGGGATCGTCGGAAAAGGAGGTGACGGGATCGTCTACAAAGGCGTCATGCCAAACAACGAGCACGTGGAGGTCCGCCCATGACCATGGATTCAATGCCGAGAT...

Protein

Download Protein FASTA

128 aa · TkA08G061640|TK1151|PROTEIN

LEPVASVDFSYNNLSGLVPGTDQFSYFNYISFLANPDLCGPYLGPCKDGMEVSGSSEKEVTGSSTKASCQTTSTWRSAHDHGFNAEIQTLGEKPDDREATGFKLVNWSRLVKINIIVLDLHKIDIRVS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G061640`
TK1151 ID	TkA08G061640
OH-1004 ID	LXL04_029426
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	92.300
Protein coverage (%)	TK1151 40.625 / OH-1004 9.647 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G061640

Location Chr08:15772567-15772953 (-)

Description Similar to NTL9: Protein NTM1-like 9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g65700`	LRR-rich receptor-like kinase (LRR-RLK) that, similarly to CLV1 and BAM3, participates in the detection of the CLAVATA-family peptides (e.g. CLE25, CLE26 and CLE45), and to the regulation of the triggered signaling required for protophloem differentiation and meristems maintenance through the phosphorylation of CIK proteins (CIKs) and of PBL34, PBL35 and PBL36.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029426 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002230 positive regulation of defense response to virus by host Biological Process

GO:0002237 response to molecule of bacterial origin Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009615 response to virus Biological Process

GO:0016032 viral process Biological Process

GO:0031347 regulation of defense response Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0051607 defense response to virus Biological Process

GO:0070417 cellular response to cold Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0071470 cellular response to osmotic stress Biological Process

KEGG gene cross-reference

ath:AT1G33060

ath:AT3G49530

ath:AT4G35580

ath:AT5G17260

ath:AT5G24590

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.360

Rank 1 · TkA08G061640 · TK1151

Cytoplasm0.246

Rank 2 · TkA08G061640 · TK1151

Nucleus0.227

Rank 3 · TkA08G061640 · TK1151

Endoplasmic reticulum0.152

Rank 4 · TkA08G061640 · TK1151

Extracellular0.093

Rank 5 · TkA08G061640 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O49545`	Arabidopsis thaliana	sp\|O49545\|BAME1_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM1	79.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card