RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA08G056330
Reference: TK1151 Chr: Chr08 Coordinates: 14420383-14422613 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1359 bp · TkA08G056330|TK1151|cDNA

AGAAACCCTAATTCTACTTACAACGATGAAGGGCATGAAGTCACTGAAGCAGCTCAAGCTCTCTGTTCCTACTCAAGATGCTCCGATTACCAGCTTCTTGACAACGAGTGGGACTTTTCATGATGGGGATTTACTTCTAAATCTGAAAGGATTAAGACTCGCATCTGAGGATAAAGAAAACCGTCCCTCCGATGCAAAGGAGATTGATCTCCAATTTTCACTAGAAGACCTCGAGACCATCTCTCAACTTGTTCGCTATA...

CDS

Download CDS FASTA

513 bp · TkA08G056330|TK1151|CDS

ATGAACAAACAAGAAGACATCCGCAAACAAATCGTTCAAGAACTTAAAATCAACCAAGCATCTCATTGCCCTAACATTGTCGTCTGTTACCACTCTTTCTACCACAATGGAGCCATCTCATTGGTCTTTGAATACATGGACCGTGGATCTTTAACAGACGTCATCAGACAACTCAAAACCATTCTCGAACCTTATCTTGCAGTTCTCTTTACAGAGGTATTACAAGGTCTTGTGTATTTACACCATGAAAGACATGTAAT...

Protein

Download Protein FASTA

170 aa · TkA08G056330|TK1151|PROTEIN

MNKQEDIRKQIVQELKINQASHCPNIVVCYHSFYHNGAISLVFEYMDRGSLTDVIRQLKTILEPYLAVLFTEVLQGLVYLHHERHVIHRDIKPSNLLVNQKGQVKITDFGISAILANSMGQRDTFVGTYNYMSPERISGKTYDYKSDIWSLGLVILECAIGRFPFIQSED

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA08G056330
TK1151 IDTkA08G056330
OH-1004 IDLXL04_002480
Relationship / confidenceSequence Supported Annotation Or Model Conflict / Review
Protein identity (%)95.900
Protein coverage (%)TK1151 100.000 / OH-1004 35.270
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA08G056330
LocationChr08:14420383-14422613 (+)
DescriptionSimilar to MKK6: Mitogen-activated protein kinase kinase 6
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g56580 The ANPs-MKK6-MPK4 module is involved in the regulation of plant cytokinesis during meiosis and mitosis.
NQK1/NtMEK1 is a MAPKK that acts in the NPK1 MAPKKK-mediated MAPK cascade and is required for plant cytokinesis.2003 · DOI: 10.1101/gad.1071103
The Arabidopsis thaliana MEK AtMKK6 activates the MAP kinase AtMPK13.2004 · DOI: 10.1016/j.febslet.2004.08.051
HINKEL kinesin, ANP MAPKKKs and MKK6/ANQ MAPKK, which phosphorylates and activates MPK4 MAPK, constitute a pathway that is required for cytokinesis in Arabidopsis thaliana.2010 · DOI: 10.1093/pcp/pcq135
The MAP kinase MPK4 is required for cytokinesis in Arabidopsis thaliana.2010 · DOI: 10.1105/tpc.110.077164
AtMPK4 is required for male-specific meiotic cytokinesis in Arabidopsis.2011 · DOI: 10.1111/j.1365-313x.2011.04642.x
AtMKK6 and AtMPK13 are required for lateral root formation in Arabidopsis.2011 · DOI: 10.4161/psb.6.10.17089
At4g29810 MEKK1, MKK1/MKK2 and MPK4 function in a signaling pathway that modulates the expression of genes responding to biotic and abiotic stresses and also plays an important role in pathogen defense by negatively regulating innate immunity.
The MKK2 pathway mediates cold and salt stress signaling in Arabidopsis.2004 · DOI: 10.1016/j.molcel.2004.06.023
The MAP kinase kinase MKK2 affects disease resistance in Arabidopsis.2007 · DOI: 10.1094/mpmi-20-5-0589
Arabidopsis mitogen-activated protein kinase kinases MKK1 and MKK2 have overlapping functions in defense signaling mediated by MEKK1, MPK4, and MKS1.2008 · DOI: 10.1104/pp.108.120006

Rice

Reference gene IDPossible functionPapers / DOI
Os01g0510100 Mitogen-activated protein kinase kinase 1. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_002480 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0002229 defense response to oomycetes Biological Process
GO:0006952 defense response Biological Process
GO:0007112 male meiosis cytokinesis Biological Process
GO:0007165 signal transduction Biological Process
GO:0010200 response to chitin Biological Process
GO:0010311 lateral root formation Biological Process
GO:0051707 response to other organism Biological Process
GO:0009507 chloroplast Cellular Component
GO:0009524 phragmoplast Cellular Component
GO:0004674 protein serine/threonine kinase activity Molecular Function
GO:0004708 MAP kinase kinase activity Molecular Function
GO:0004713 protein tyrosine kinase activity Molecular Function
KEGG gene cross-reference
ath:AT5G56580
dosa:Os01g0510100
nta:107818847
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.677
Rank 1 · TkA08G056330 · TK1151
Nucleus0.476
Rank 2 · TkA08G056330 · TK1151
Cell membrane0.062
Rank 3 · TkA08G056330 · TK1151
Mitochondrion0.061
Rank 4 · TkA08G056330 · TK1151
Lysosome / Vacuole0.045
Rank 5 · TkA08G056330 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase4-168 aa
PF07714PK_Tyr_Ser-Thr4-165 aa
PF01636APH19-53 aa
PF03109ABC141-116 aa
PF01163RIO142-110 aa
PF17667Pkinase_fungal67-151 aa
PF07387Seadorna_VP774-109 aa
PF01636APH75-104 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA08G056330PF00069Pkinase41686.9e-51173.9
TkA08G056330PF07714PK_Tyr_Ser-Thr41654.8e-31108.7
TkA08G056330PF01636APH19530.0116.4
TkA08G056330PF03109ABC1411162.6e-0524.2
TkA08G056330PF01163RIO1421100.05113.9
TkA08G056330PF17667Pkinase_fungal671512.5e-0523.9
TkA08G056330PF07387Seadorna_VP7741090.01215.4
TkA08G056330PF01636APH751040.0116.4
TkA08G056330PF14531Kinase-like781658.2e-0522.7
TkA08G056330PF12330Haspin_kinase791500.06413.0
TkA08G056330PF10140YukC821290.2211.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9FJV0Arabidopsis thalianasp|Q9FJV0|M2K6_ARATH Mitogen-activated protein kinase kinase 682.500%Swiss-ProtHigh
Q9S7U9Arabidopsis thalianasp|Q9S7U9|M2K2_ARATH Mitogen-activated protein kinase kinase 262.900%Swiss-ProtHigh
Q5QN75Oryza sativa subsp. japonicasp|Q5QN75|M2K1_ORYSJ Mitogen-activated protein kinase kinase 180.500%Swiss-ProtHigh

JBrowse

View in Genome Browser