RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA08G054460
Reference: TK1151 Chr: Chr08 Coordinates: 13961069-13963997 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1636 bp · TkA08G054460|TK1151|cDNA

ATTGCGTGCGTGCCTTTTCCCAGATTCAAATTCCAAACCCCTCCAAACCCATCGTCCTCCCCTTCAAATCAGTCTCTTTCCCCCCTTCGATTTTGAATCCATAGCAATCACCTTATCAGTAGAAATAATCAGTTTTTGCATCTAAAATCCGACTATATCGAAGATTAAGAGAGAATCGATGAAGGGCGATGAATCTAAAAGTGGAGGTGGAGGTGAAGGAGCAGTGTTAAAAGGAGTGCCGGCGTACGGCGGCAAATACA...

CDS

Download CDS FASTA

1140 bp · TkA08G054460|TK1151|CDS

ATGAAGGGCGATGAATCTAAAAGTGGAGGTGGAGGTGAAGGAGCAGTGTTAAAAGGAGTGCCGGCGTACGGCGGCAAATACATTCATTACAACGTACTCGGAAACCTATTCGAGGTTTCTTCCAAATACGTTCCTCCCATTCAACCTGTAGGCCGTGGTGCATACGGCATCGTTTGTTGTGCTAAAGATTCTGAAACAAAAGAAGATGTTGCAATCAAGAAAATCGGAAATGCATTTGACAACAGCATCGATGCCAAAAG...

Protein

Download Protein FASTA

379 aa · TkA08G054460|TK1151|PROTEIN

MKGDESKSGGGGEGAVLKGVPAYGGKYIHYNVLGNLFEVSSKYVPPIQPVGRGAYGIVCCAKDSETKEDVAIKKIGNAFDNSIDAKRTLREIKLLCHMDHENIIKIKDIIRPPDKQKFNDVYIVYELMDTDLHQIIRSSQSLTDDHCQYFLYQLLRGLKYVHSANVLHRDLKPSNLLLNANCDLKICDFGLARTTSETDFMTEYVVTRWYRAPELLLNCSEYTTAIDIWSVGCILMEIALREPLFPGKDYVQQLVLITEL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA08G054460
TK1151 IDTkA08G054460
OH-1004 IDLXL04_017708
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)100.000
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA08G054460
LocationChr08:13961069-13963997 (-)
DescriptionSimilar to NTF6: Mitogen-activated protein kinase homolog NTF6
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g07880 MKK6-MPK13 module positively regulates lateral root formation.
AtMKK6 and AtMPK13 are required for lateral root formation in Arabidopsis.2011 · DOI: 10.4161/psb.6.10.17089
At4g01370 The ANPs-MKK6-MPK4 module is involved in the regulation of plant cytokinesis during meiosis and mitosis.
Arabidopsis map kinase 4 negatively regulates systemic acquired resistance.2000 · DOI: 10.1016/s0092-8674(00)00213-0
The MKK2 pathway mediates cold and salt stress signaling in Arabidopsis.2004 · DOI: 10.1016/j.molcel.2004.06.023
Involvement of MPK4 in osmotic stress response pathways in cell suspensions and plantlets of Arabidopsis thaliana: activation by hypoosmolarity and negative role in hyperosmolarity tolerance.2004 · DOI: 10.1016/j.febslet.2004.08.001
The MAP kinase substrate MKS1 is a regulator of plant defense responses.2005 · DOI: 10.1038/sj.emboj.7600737
Arabidopsis homologs of nucleus- and phragmoplast-localized kinase 2 and 3 and mitogen-activated protein kinase 4 are essential for microtubule organization.2010 · DOI: 10.1105/tpc.109.071746
HINKEL kinesin, ANP MAPKKKs and MKK6/ANQ MAPKK, which phosphorylates and activates MPK4 MAPK, constitute a pathway that is required for cytokinesis in Arabidopsis thaliana.2010 · DOI: 10.1093/pcp/pcq135
The MAP kinase MPK4 is required for cytokinesis in Arabidopsis thaliana.2010 · DOI: 10.1105/tpc.110.077164
AtMPK4 is required for male-specific meiotic cytokinesis in Arabidopsis.2011 · DOI: 10.1111/j.1365-313x.2011.04642.x
The MEKK1-MKK1/MKK2-MPK4 kinase cascade negatively regulates immunity mediated by a mitogen-activated protein kinase kinase kinase in Arabidopsis.2012 · DOI: 10.1105/tpc.112.097253
Phosphorylation of trihelix transcriptional repressor ASR3 by MAP KINASE4 negatively regulates Arabidopsis immunity.2015 · DOI: 10.1105/tpc.114.134809
A Dominant Mutation in the HT1 Kinase Uncovers Roles of MAP Kinases and GHR1 in CO2-Induced Stomatal Closure.2016 · DOI: 10.1105/tpc.16.00131

Rice

Reference gene IDPossible functionPapers / DOI
Os10g0533600 Mitogen-activated protein kinase 6. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_017708 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000911 cytokinesis by cell plate formation Biological Process
GO:0006468 protein phosphorylation Biological Process
GO:0006972 hyperosmotic response Biological Process
GO:0007112 male meiosis cytokinesis Biological Process
GO:0007165 signal transduction Biological Process
GO:0009409 response to cold Biological Process
GO:0009555 pollen development Biological Process
GO:0009611 response to wounding Biological Process
GO:0009620 response to fungus Biological Process
GO:0009651 response to salt stress Biological Process
GO:0009737 response to abscisic acid Biological Process
GO:0009861 jasmonic acid and ethylene-dependent systemic resistance Biological Process
KEGG gene cross-reference
ath:AT1G07880
ath:AT4G01370
dosa:Os10g0533600
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.611
Rank 1 · TkA08G054460 · TK1151
Cytoplasm0.579
Rank 2 · TkA08G054460 · TK1151
Cell membrane0.068
Rank 3 · TkA08G054460 · TK1151
Mitochondrion0.044
Rank 4 · TkA08G054460 · TK1151
Endoplasmic reticulum0.033
Rank 5 · TkA08G054460 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase48-330 aa
PF07714PK_Tyr_Ser-Thr48-240 aa
PF01163RIO181-194 aa
PF06293Kdo82-186 aa
PF14531Kinase-like89-238 aa
PF12330Haspin_kinase113-198 aa
PF03109ABC1160-198 aa
PF03109ABC1321-344 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA08G054460PF00069Pkinase483308.1e-69232.7
TkA08G054460PF07714PK_Tyr_Ser-Thr482401.7e-33116.8
TkA08G054460PF01163RIO1811940.01615.6
TkA08G054460PF06293Kdo821860.02214.9
TkA08G054460PF14531Kinase-like892380.002118.1
TkA08G054460PF12330Haspin_kinase1131980.007116.1
TkA08G054460PF03109ABC11601980.0006619.6
TkA08G054460PF03109ABC13213440.0006619.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LQQ9Arabidopsis thalianasp|Q9LQQ9|MPK13_ARATH Mitogen-activated protein kinase 1377.300%Swiss-ProtHigh
Q39024Arabidopsis thalianasp|Q39024|MPK4_ARATH Mitogen-activated protein kinase 475.300%Swiss-ProtHigh
Q336X9Oryza sativa subsp. japonicasp|Q336X9|MPK6_ORYSJ Mitogen-activated protein kinase 676.100%Swiss-ProtHigh

JBrowse

View in Genome Browser