LXL04_017708 | RubberDandelionOmics

Gene overview

LXL04_017708

Reference: OH-1004 Chr: Chr04 Coordinates: 182905-185348 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1140 bp · LXL04_017708|LXL04_017708|OH1004|cDNA

ATGAAGGGCGATGAATCTAAAAGTGGAGGTGGAGGTGAAGGAGCAGTGTTAAAAGGAGTGCCGGCGTACGGCGGCAAATACATTCATTACAACGTACTCGGAAACCTATTCGAGGTTTCTTCCAAATACGTTCCTCCCATTCAACCTGTAGGCCGTGGTGCATACGGCATCGTTTGTTGTGCTAAAGAttctgaaacaaaagaagatgttgCAATCAAGAAAATCGGAAATGCATTTGACAACAGCATCGATGCCAAAAG...

CDS

Download CDS FASTA

1140 bp · LXL04_017708|LXL04_017708|OH1004|CDS

ATGAAGGGCGATGAATCTAAAAGTGGAGGTGGAGGTGAAGGAGCAGTGTTAAAAGGAGTGCCGGCGTACGGCGGCAAATACATTCATTACAACGTACTCGGAAACCTATTCGAGGTTTCTTCCAAATACGTTCCTCCCATTCAACCTGTAGGCCGTGGTGCATACGGCATCGTTTGTTGTGCTAAAGATTCTGAAACAAAAGAAGATGTTGCAATCAAGAAAATCGGAAATGCATTTGACAACAGCATCGATGCCAAAAG...

Protein

Download Protein FASTA

379 aa · LXL04_017708|LXL04_017708|OH1004|PROTEIN

MKGDESKSGGGGEGAVLKGVPAYGGKYIHYNVLGNLFEVSSKYVPPIQPVGRGAYGIVCCAKDSETKEDVAIKKIGNAFDNSIDAKRTLREIKLLCHMDHENIIKIKDIIRPPDKQKFNDVYIVYELMDTDLHQIIRSSQSLTDDHCQYFLYQLLRGLKYVHSANVLHRDLKPSNLLLNANCDLKICDFGLARTTSETDFMTEYVVTRWYRAPELLLNCSEYTTAIDIWSVGCILMEIALREPLFPGKDYVQQLVLITEL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017708`
TK1151 ID	TkA08G054460
OH-1004 ID	LXL04_017708
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017708

Location Chr04:182905-185348 (+)

Description Similar to NTF6: Mitogen-activated protein kinase homolog NTF6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g07880`	MKK6-MPK13 module positively regulates lateral root formation.	AtMKK6 and AtMPK13 are required for lateral root formation in Arabidopsis.2011 · DOI: 10.4161/psb.6.10.17089
`At4g01370`	The ANPs-MKK6-MPK4 module is involved in the regulation of plant cytokinesis during meiosis and mitosis.	Arabidopsis map kinase 4 negatively regulates systemic acquired resistance.2000 · DOI: 10.1016/s0092-8674(00)00213-0 The MKK2 pathway mediates cold and salt stress signaling in Arabidopsis.2004 · DOI: 10.1016/j.molcel.2004.06.023 Involvement of MPK4 in osmotic stress response pathways in cell suspensions and plantlets of Arabidopsis thaliana: activation by hypoosmolarity and negative role in hyperosmolarity tolerance.2004 · DOI: 10.1016/j.febslet.2004.08.001 The MAP kinase substrate MKS1 is a regulator of plant defense responses.2005 · DOI: 10.1038/sj.emboj.7600737 Arabidopsis homologs of nucleus- and phragmoplast-localized kinase 2 and 3 and mitogen-activated protein kinase 4 are essential for microtubule organization.2010 · DOI: 10.1105/tpc.109.071746 HINKEL kinesin, ANP MAPKKKs and MKK6/ANQ MAPKK, which phosphorylates and activates MPK4 MAPK, constitute a pathway that is required for cytokinesis in Arabidopsis thaliana.2010 · DOI: 10.1093/pcp/pcq135 The MAP kinase MPK4 is required for cytokinesis in Arabidopsis thaliana.2010 · DOI: 10.1105/tpc.110.077164 AtMPK4 is required for male-specific meiotic cytokinesis in Arabidopsis.2011 · DOI: 10.1111/j.1365-313x.2011.04642.x The MEKK1-MKK1/MKK2-MPK4 kinase cascade negatively regulates immunity mediated by a mitogen-activated protein kinase kinase kinase in Arabidopsis.2012 · DOI: 10.1105/tpc.112.097253 Phosphorylation of trihelix transcriptional repressor ASR3 by MAP KINASE4 negatively regulates Arabidopsis immunity.2015 · DOI: 10.1105/tpc.114.134809 A Dominant Mutation in the HT1 Kinase Uncovers Roles of MAP Kinases and GHR1 in CO2-Induced Stomatal Closure.2016 · DOI: 10.1105/tpc.16.00131

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0533600`	Mitogen-activated protein kinase 6.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017708 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000911 cytokinesis by cell plate formation Biological Process

GO:0006468 protein phosphorylation Biological Process

GO:0006972 hyperosmotic response Biological Process

GO:0007112 male meiosis cytokinesis Biological Process

GO:0007165 signal transduction Biological Process

GO:0009409 response to cold Biological Process

GO:0009555 pollen development Biological Process

GO:0009611 response to wounding Biological Process

GO:0009620 response to fungus Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009861 jasmonic acid and ethylene-dependent systemic resistance Biological Process

KEGG gene cross-reference

ath:AT1G07880

ath:AT4G01370

dosa:Os10g0533600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.611

Rank 1 · LXL04_017708 · OH-1004

Cytoplasm0.579

Rank 2 · LXL04_017708 · OH-1004

Cell membrane0.068

Rank 3 · LXL04_017708 · OH-1004

Mitochondrion0.044

Rank 4 · LXL04_017708 · OH-1004

Endoplasmic reticulum0.033

Rank 5 · LXL04_017708 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase48-330 aa

PF07714.24PK_Tyr_Ser-Thr48-240 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017708	`PF00069.32`	Pkinase	48	330	8.1e-69	232.7
LXL04_017708	`PF07714.24`	PK_Tyr_Ser-Thr	48	240	1.7e-33	116.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LQQ9`	Arabidopsis thaliana	Mitogen-activated protein kinase 13	77.337%	Swiss-Prot	strong database homology
`Q39024`	Arabidopsis thaliana	Mitogen-activated protein kinase 4	75.335%	Swiss-Prot	strong database homology
`Q336X9`	Oryza sativa subsp. japonica	Mitogen-activated protein kinase 6	76.257%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card