TkA08G050370 | RubberDandelionOmics

Gene overview

TkA08G050370

Reference: TK1151 Chr: Chr08 Coordinates: 12835110-12839825 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3088 bp · TkA08G050370|TK1151|cDNA

AAACATCACAATCGGGTCTAACTAAAAGTCAAACATATTTTTCTTAAATAATTCCCTCAAATCCCACTTTAATGGTCGAAAAATCCTACACGGTAGTTAAGCAACATCAACGGAAGTTACGAAGAAAGATCAGAGTTTTTGACACTTGAAGCGAAGTGGGTTTTAGCAATTAATGGAACTTCTGAGACCATCTCACCCTCCTATCACAATGGCCGCCGACGGCTGCTCTGGGTTTTCTCCGACGGCGAGTTGCGGAGATG...

CDS

Download CDS FASTA

2379 bp · TkA08G050370|TK1151|CDS

ATGGAACTTCTGAGACCATCTCACCCTCCTATCACAATGGCCGCCGACGGCTGCTCTGGGTTTTCTCCGACGGCGAGTTGCGGAGATGGGTTTCACCGGAACAGTCTCCCGGCGACGGATATTGGCGGTGGTGATAAGGTTTATGTGGCTGTTGGGAAGTCGGTGGAAAAGGCAGTAGCTTTGTTTCACTGGACTTTTCGGAGGTTTAGAGGTCGAGAGATTTGCATACTTCATGTTCATCAACCTTCTCCCTTGATTCC...

Protein

Download Protein FASTA

792 aa · TkA08G050370|TK1151|PROTEIN

MELLRPSHPPITMAADGCSGFSPTASCGDGFHRNSLPATDIGGGDKVYVAVGKSVEKAVALFHWTFRRFRGREICILHVHQPSPLIPTLLGKLPATQANPDVVREHRNKERDQMNKLLLDYMSLCVRSKFKASFVTIDSDQVRKGIVNLVNENGVQKLVMGAVPESWIKVKKNASKSSYAAKNVPPFCQIWFVNVNKGQLLYTKEPESNDVMPPSIRQDLNTLRSQSSRIERGIQQVHHRSISSHPLPSLLSVSSDSGCS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G050370`
TK1151 ID	TkA08G050370
OH-1004 ID	LXL04_017799
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G050370

Location Chr08:12835110-12839825 (-)

Description Similar to PUB33: U-box domain-containing protein 33

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g45910`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release
`At3g49060`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release
`At5g51270`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release
`At5g61550`	Functions as an E3 ubiquitin ligase.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0163000`	Functions as an E3 ubiquitin ligase.	MODD Mediates Deactivation and Degradation of OsbZIP46 to Negatively Regulate ABA Signaling and Drought Resistance in Rice.2016 · DOI: 10.1105/tpc.16.00171

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017799 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016567 protein ubiquitination Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004842 ubiquitin-protein transferase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0061630 ubiquitin protein ligase activity Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT2G45910

ath:AT3G49060

dosa:Os03g0424200

dosa:Os06g0163000

osa:4340220

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.432

Rank 1 · TkA08G050370 · TK1151

Cell membrane0.427

Rank 2 · TkA08G050370 · TK1151

Nucleus0.303

Rank 3 · TkA08G050370 · TK1151

Endoplasmic reticulum0.040

Rank 4 · TkA08G050370 · TK1151

Golgi apparatus0.037

Rank 5 · TkA08G050370 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00582Usp46-168 aa

PF00261Tropomyosin272-412 aa

PF16566CREPT296-368 aa

PF00069Pkinase328-328 aa

PF00582Usp328-340 aa

PF22783BapA_N356-406 aa

PF00069Pkinase455-705 aa

PF07714PK_Tyr_Ser-Thr459-706 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G050370	`PF00582`	Usp	46	168	0.011	16.9
TkA08G050370	`PF00261`	Tropomyosin	272	412	0.18	11.9
TkA08G050370	`PF16566`	CREPT	296	368	6.1	7.6
TkA08G050370	`PF00069`	Pkinase	328	328	2.2e-30	106.7
TkA08G050370	`PF00582`	Usp	328	340	0.011	16.9
TkA08G050370	`PF22783`	BapA_N	356	406	0.25	11.8
TkA08G050370	`PF00069`	Pkinase	455	705	2.2e-30	106.7
TkA08G050370	`PF07714`	PK_Tyr_Ser-Thr	459	706	2.1e-31	109.9
TkA08G050370	`PF01635`	CoV_M	607	646	0.092	12.9
TkA08G050370	`PF04564`	U-box	722	790	8.3e-17	61.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GUH1`	Arabidopsis thaliana	sp\|Q8GUH1\|PUB33_ARATH U-box domain-containing protein 33	34.700%	Swiss-Prot	Medium
`Q94A51`	Arabidopsis thaliana	sp\|Q94A51\|PUB32_ARATH U-box domain-containing protein 32	28.700%	Swiss-Prot	Low
`Q9LU47`	Arabidopsis thaliana	sp\|Q9LU47\|PUB53_ARATH Putative U-box domain-containing protein 53	38.900%	Swiss-Prot	Low
`Q9FKG6`	Arabidopsis thaliana	sp\|Q9FKG6\|PUB52_ARATH U-box domain-containing protein 52	38.500%	Swiss-Prot	Low
`Q5WA76`	Oryza sativa subsp. japonica	sp\|Q5WA76\|PUB70_ORYSJ U-box domain-containing protein 70	44.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card