Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1866 bp · TkA08G049630|TK1151|cDNA
GGAAGTATTCAACTTGTGATTTGATCTTAATGTCACATAACTCATTTTTTCTCTCTTCTTTGAATTTCTTTTCAGAAATCGTGTAAGTCAGCTAGTAATTTAAGCAAGAAATTGTAGTTATCATGCCACCTCTCAAACAATTATAGATCATTAATCATGTGGTCACGTTGCAAGAATCCACTTCATCATTTAGAGACATTACAAAAATACTCAAAATCACCATGGAATTTTCAAACTTGTGGATTTTCAGATGCCCCTTT...
1473 bp · TkA08G049630|TK1151|CDS
ATGTGGTCACGTTGCAAGAATCCACTTCATCATTTAGAGACATTACAAAAATACTCAAAATCACCATGGAATTTTCAAACTTGTGGATTTTCAGATGCCCCTTTCAAAAAACCAAAGCTTGCACCCCTACAGGAGCAAAGAATGATTGACCGGAGAAGGTTGTGGGCTAAAGGAGGAGATGGCGGCAATGGCTGCTTTAGCTTCCACCGGAGCCGCCATGACCGCCGTGGTAGAGCTGATGGCGGCAATGGTGGAAGAGG...
Protein
Download Protein FASTA490 aa · TkA08G049630|TK1151|PROTEIN
MWSRCKNPLHHLETLQKYSKSPWNFQTCGFSDAPFKKPKLAPLQEQRMIDRRRLWAKGGDGGNGCFSFHRSRHDRRGRADGGNGGRGGDVILECSPTIWDLSSLQHHINAKKGGHGASKNMIGTRGDDKVVLVPIGTVLHLVEGEMPSVVQKGHSTPLNPWDIPDNTPDPNPPATCHQSNESPIKTEKTEKTERFDFWNEETMKKWEARVISNGESESESETQSEEEHIEYNIAELTEPGQRIVIAHGGTGGLGNISLTK...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G049630 |
|---|---|
| TK1151 ID | TkA08G049630 |
| OH-1004 ID | LXL04_017804 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.200 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G049630 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr08:12640150-12643374 (-) | ||||||||||||
| Description | Similar to ATOBGM: Probable GTP-binding protein OBGM, mitochondrial | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0042254 ribosome biogenesis Biological Process GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0000287 magnesium ion binding Molecular Function GO:0003924 GTPase activity Molecular Function GO:0005525 GTP binding Molecular Function GO:0043022 ribosome binding Molecular Function | ||||||||||||
| KEGG gene cross-reference | amu:Amuc_0728 ath:AT1G07615 dosa:Os11g0704300 lsp:Bsph_3946 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF01018GTP1_OBG49-140 aaPF13238AAA_1865-97 aaPF00350Dynamin_N187-242 aaPF19993DO-GTPase2190-214 aaPF01018GTP1_OBG228-300 aaPF00009GTP_EFTU301-331 aaPF01926MMR_HSR1304-430 aaPF02421FeoB_N305-359 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA08G049630 | PF01018 | GTP1_OBG | 49 | 140 | 1.8e-33 | 116.1 |
| TkA08G049630 | PF13238 | AAA_18 | 65 | 97 | 0.01 | 17.0 |
| TkA08G049630 | PF00350 | Dynamin_N | 187 | 242 | 0.029 | 15.1 |
| TkA08G049630 | PF19993 | DO-GTPase2 | 190 | 214 | 0.86 | 9.9 |
| TkA08G049630 | PF01018 | GTP1_OBG | 228 | 300 | 1.8e-33 | 116.1 |
| TkA08G049630 | PF00009 | GTP_EFTU | 301 | 331 | 0.25 | 11.6 |
| TkA08G049630 | PF01926 | MMR_HSR1 | 304 | 430 | 5.8e-24 | 85.1 |
| TkA08G049630 | PF02421 | FeoB_N | 305 | 359 | 1.1e-10 | 42.0 |
| TkA08G049630 | PF13238 | AAA_18 | 305 | 389 | 0.01 | 17.0 |
| TkA08G049630 | PF00350 | Dynamin_N | 305 | 326 | 0.029 | 15.1 |
| TkA08G049630 | PF19993 | DO-GTPase2 | 305 | 322 | 0.86 | 9.9 |
| TkA08G049630 | PF00025 | Arf | 307 | 465 | 1.3e-05 | 25.5 |
| TkA08G049630 | PF00350 | Dynamin_N | 345 | 390 | 0.029 | 15.1 |
| TkA08G049630 | PF00009 | GTP_EFTU | 423 | 466 | 0.25 | 11.6 |
| TkA08G049630 | PF02421 | FeoB_N | 424 | 468 | 1.1e-10 | 42.0 |
| TkA08G049630 | PF13238 | AAA_18 | 434 | 447 | 0.01 | 17.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.