LXL04_017804 | RubberDandelionOmics

Gene overview

LXL04_017804

Reference: OH-1004 Chr: Chr04 Coordinates: 1426941-1428855 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1473 bp · LXL04_017804|LXL04_017804|OH1004|cDNA

ATGTGGTCACGTTGCAAGAATCCACTTCATCATTTGGAGACATTACAAAAATACTCAAAATCACCATGGATTTTTCAAACTTGTGGATTTTCAGATGCCCCTTTCAAAAAACCAAAGCTTGCACCCCTACAGGAGCAAAGAATGATTGACCGGAGGAGGTTGTGGGCTAAAGGAGGAGATGGCGGCAATGGCTGCTTTAGCTTCCACCGTAGCCGCCATGACCGCCGTGGTAGAGCTGATGGCGGCAATGGTGGAAGAGG...

CDS

Download CDS FASTA

1473 bp · LXL04_017804|LXL04_017804|OH1004|CDS

ATGTGGTCACGTTGCAAGAATCCACTTCATCATTTGGAGACATTACAAAAATACTCAAAATCACCATGGATTTTTCAAACTTGTGGATTTTCAGATGCCCCTTTCAAAAAACCAAAGCTTGCACCCCTACAGGAGCAAAGAATGATTGACCGGAGGAGGTTGTGGGCTAAAGGAGGAGATGGCGGCAATGGCTGCTTTAGCTTCCACCGTAGCCGCCATGACCGCCGTGGTAGAGCTGATGGCGGCAATGGTGGAAGAGG...

Protein

Download Protein FASTA

490 aa · LXL04_017804|LXL04_017804|OH1004|PROTEIN

MWSRCKNPLHHLETLQKYSKSPWIFQTCGFSDAPFKKPKLAPLQEQRMIDRRRLWAKGGDGGNGCFSFHRSRHDRRGRADGGNGGRGGDVILECSPTIWDLSSLQHHINAKKGGHGASKNMIGTRGDDKVVLVPIGTVLHLVEGAMPCVVQKGYSTPLNPWDIPDNTPDPNPPATCHQSNESPIKTEKTEKTERFDFWNEETMKKWEARVISNGESESESETQSEEEHIEYNIAELTEPGQRIVIAHGGTGGLGNISLTK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017804`
TK1151 ID	TkA08G049630
OH-1004 ID	LXL04_017804
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017804

Location Chr04:1426941-1428855 (+)

Description Similar to ATOBGM: Probable GTP-binding protein OBGM, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g07615`	May bind GTP and have GTPase activity.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os11g0704300`	May bind GTP and have GTPase activity.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017804 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0042254 ribosome biogenesis Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0003924 GTPase activity Molecular Function

GO:0005525 GTP binding Molecular Function

GO:0043022 ribosome binding Molecular Function

KEGG gene cross-reference

amu:Amuc_0728

ath:AT1G07615

dosa:Os11g0704300

lsp:Bsph_3946

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.914

Rank 1 · LXL04_017804 · OH-1004

Cytoplasm0.077

Rank 2 · LXL04_017804 · OH-1004

Nucleus0.075

Rank 3 · LXL04_017804 · OH-1004

Plastid0.015

Rank 4 · LXL04_017804 · OH-1004

Cell membrane0.014

Rank 5 · LXL04_017804 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01018.29GTP1_OBG49-140 aa

PF01018.29GTP1_OBG228-300 aa

PF01926.30MMR_HSR1304-430 aa

PF02421.25FeoB_N305-359 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017804	`PF01018.29`	GTP1_OBG	49	140	9.4e-34	117.0
LXL04_017804	`PF01018.29`	GTP1_OBG	228	300	9.4e-34	117.0
LXL04_017804	`PF01926.30`	MMR_HSR1	304	430	5.8e-24	85.1
LXL04_017804	`PF02421.25`	FeoB_N	305	359	1.1e-10	42.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HSD4`	Arabidopsis thaliana	Probable GTP-binding protein OBGM, mitochondrial	54.941%	Swiss-Prot	strong database homology
`Q2QZ37`	Oryza sativa subsp. japonica	Probable GTP-binding protein OBGM, mitochondrial	63.878%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card