TkA08G045240 | RubberDandelionOmics

Gene overview

TkA08G045240

Reference: TK1151 Chr: Chr08 Coordinates: 11541371-11548159 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

711 bp · TkA08G045240|TK1151|cDNA

ATGATCGGGGTGTGCCGATGGTGTTGCCGAGCTGGTCCGGTCAGTGATCGAGGAATGCCGATGGTGTCCGGGAGGTTGCCGATGGAATTGGTTCAGGCATTTTATCGAACACCTGGTGTGCGGGTTGGGGTAGCTGAGATGAAAGTTGTGATTGAAAGGACAGGTGGACTTGTTGTTTTAGCTGAAAGTTTTGGTCGTTCGGTTTTCAAAGACTCATTTAGGCGTGTCTTTAAGAAGGGTGAAGAATCTCTTGGTCTCTC...

CDS

Download CDS FASTA

711 bp · TkA08G045240|TK1151|CDS

ATGATCGGGGTGTGCCGATGGTGTTGCCGAGCTGGTCCGGTCAGTGATCGAGGAATGCCGATGGTGTCCGGGAGGTTGCCGATGGAATTGGTTCAGGCATTTTATCGAACACCTGGTGTGCGGGTTGGGGTAGCTGAGATGAAAGTTGTGATTGAAAGGACAGGTGGACTTGTTGTTTTAGCTGAAAGTTTTGGTCGTTCGGTTTTCAAAGACTCATTTAGGCGTGTCTTTAAGAAGGGTGAAGAATCTCTTGGTCTCTC...

Protein

Download Protein FASTA

236 aa · TkA08G045240|TK1151|PROTEIN

MIGVCRWCCRAGPVSDRGMPMVSGRLPMELVQAFYRTPGVRVGVAEMKVVIERTGGLVVLAESFGRSVFKDSFRRVFKKGEESLGLSHNGTLEINCREHNDWTGEHKDDMFLGNIKMHVDYCMHRVNLLRHFGIKLILVFDGGQGRKILHVLLSMKNLETHQQLMNVIKKTIDISPTIAYELIQVLKQENISYVVAPYEADAKMTFLALRKHVDAVITDDSNLIPFGCPRVSSKFL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G045240`
TK1151 ID	TkA08G045240
OH-1004 ID	LXL04_017852
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 81.780 / OH-1004 75.097 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G045240

Location Chr08:11541371-11548159 (-)

Description Similar to EXO1: Exonuclease 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g29630`	Putative 5'->3' double-stranded DNA exonuclease which may also contain a cryptic 3'->5' double-stranded DNA exonuclease activity.	No verified direct reference in this release
`At1g05520`	Component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER) (By similarity).	No verified direct reference in this release
`At4g14160`	Component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER).	No verified direct reference in this release
`At3g23660`	Component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0777300`	Putative 5'->3' double-stranded DNA exonuclease which may also contain a cryptic 3'->5' double-stranded DNA exonuclease activity.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017852 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0006886 intracellular protein transport Biological Process

GO:0090110 COPII-coated vesicle cargo loading Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005829 cytosol Cellular Component

GO:0030127 COPII vesicle coat Cellular Component

GO:0070971 endoplasmic reticulum exit site Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0005096 GTPase activator activity Molecular Function

KEGG gene cross-reference

ath:AT1G05520

ath:AT1G29630

ath:AT3G23660

ath:AT4G14160

dosa:Os01g0777300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.322

Rank 1 · TkA08G045240 · TK1151

Nucleus0.220

Rank 2 · TkA08G045240 · TK1151

Mitochondrion0.210

Rank 3 · TkA08G045240 · TK1151

Peroxisome0.119

Rank 4 · TkA08G045240 · TK1151

Plastid0.082

Rank 5 · TkA08G045240 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04811Sec23_trunk41-77 aa

PF00752XPG_N113-144 aa

PF26257DUF8061155-195 aa

PF12813XPG_I_2185-225 aa

PF00867XPG_I190-235 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G045240	`PF04811`	Sec23_trunk	41	77	0.00032	21.1
TkA08G045240	`PF00752`	XPG_N	113	144	0.0032	18.6
TkA08G045240	`PF26257`	DUF8061	155	195	0.18	13.0
TkA08G045240	`PF12813`	XPG_I_2	185	225	0.0087	16.3
TkA08G045240	`PF00867`	XPG_I	190	235	1.2e-12	48.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L6Z7`	Arabidopsis thaliana	sp\|Q8L6Z7\|EXO1_ARATH Exonuclease 1	51.800%	Swiss-Prot	Medium
`Q8H0S3`	Arabidopsis thaliana	sp\|Q8H0S3\|SC23B_ARATH Protein transport protein SEC23 B	78.600%	Swiss-Prot	Low
`Q8VXX0`	Arabidopsis thaliana	sp\|Q8VXX0\|SC23F_ARATH Protein transport protein SEC23 F	76.800%	Swiss-Prot	Low
`Q9LUG1`	Arabidopsis thaliana	sp\|Q9LUG1\|SC23E_ARATH Protein transport protein SEC23 E	72.400%	Swiss-Prot	Low
`Q60GC1`	Oryza sativa subsp. japonica	sp\|Q60GC1\|EXO1_ORYSJ Exonuclease 1	53.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card