TkA08G041920 | RubberDandelionOmics

Gene overview

TkA08G041920

Reference: TK1151 Chr: Chr08 Coordinates: 10690619-10690990 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

372 bp · TkA08G041920|TK1151|cDNA

ATGGGTCCTCCATTAACAACCCCTTTCTTCCTCATCGTACTCTCCATCTGTTCTTCAACTTGTTCCTATGCAGACCTCACAACTTTCGTTTACAAAGGATGTGCTAACCAAAGATTTCAAGACCCATCTGGTATCTCATCGCAAAACCTCAAATCCCTCTACGCGAATCTCATATCCCAATCATCCACCACCAATTTCTACAACACCACCACGGGAAATGGCCAATTAACAACCTCCATCAGCGGACTTTACCAGTGCCG...

CDS

Download CDS FASTA

372 bp · TkA08G041920|TK1151|CDS

ATGGGTCCTCCATTAACAACCCCTTTCTTCCTCATCGTACTCTCCATCTGTTCTTCAACTTGTTCCTATGCAGACCTCACAACTTTCGTTTACAAAGGATGTGCTAACCAAAGATTTCAAGACCCATCTGGTATCTCATCGCAAAACCTCAAATCCCTCTACGCGAATCTCATATCCCAATCATCCACCACCAATTTCTACAACACCACCACGGGAAATGGCCAATTAACAACCTCCATCAGCGGACTTTACCAGTGCCG...

Protein

Download Protein FASTA

123 aa · TkA08G041920|TK1151|PROTEIN

MGPPLTTPFFLIVLSICSSTCSYADLTTFVYKGCANQRFQDPSGISSQNLKSLYANLISQSSTTNFYNTTTGNGQLTTSISGLYQCRGDLPNYDCNTCVKKIPDCNTCVKLFRRYAVEIQSLL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G041920`
TK1151 ID	TkA08G041920
OH-1004 ID	LXL04_036824
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.100
Protein coverage (%)	TK1151 84.553 / OH-1004 29.971 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G041920

Location Chr08:10690619-10690990 (-)

Description Similar to PDLP2: Plasmodesmata-located protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g04520`	Modulates cell-to-cell trafficking.	No verified direct reference in this release
`At2g33330`	Modulates cell-to-cell trafficking.	No verified direct reference in this release
`At5g43980`	Modulates cell-to-cell trafficking.	The plasmodesmal protein PDLP1 localises to haustoria-associated membranes during downy mildew infection and regulates callose deposition.2014 · DOI: 10.1371/journal.ppat.1004496
`At2g01660`	Modulates cell-to-cell trafficking.	No verified direct reference in this release
`At5g48540`	Cysteine-rich repeat secretory protein 55.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036824 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009615 response to virus Biological Process

GO:0010497 plasmodesmata-mediated intercellular transport Biological Process

GO:0046739 transport of virus in multicellular host Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0001872 (1->3)-beta-D-glucan binding Molecular Function

KEGG gene cross-reference

ath:AT1G04520

ath:AT2G33330

ath:AT3G04370

ath:AT5G37660

ath:AT5G43980

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.440

Rank 1 · TkA08G041920 · TK1151

Cell membrane0.264

Rank 2 · TkA08G041920 · TK1151

Endoplasmic reticulum0.153

Rank 3 · TkA08G041920 · TK1151

Cytoplasm0.082

Rank 4 · TkA08G041920 · TK1151

Lysosome / Vacuole0.037

Rank 5 · TkA08G041920 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11389Porin_OmpL128-75 aa

PF01657Stress-antifung41-104 aa

PF23077zf-C2H2_ZNF462_1st83-87 aa

PF23244VWF92-99 aa

PF23077zf-C2H2_ZNF462_1st93-100 aa

PF23244VWF104-109 aa

PF23077zf-C2H2_ZNF462_1st105-113 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G041920	`PF11389`	Porin_OmpL1	28	75	0.11	12.4
TkA08G041920	`PF01657`	Stress-antifung	41	104	1.7e-09	39.0
TkA08G041920	`PF23077`	zf-C2H2_ZNF462_1st	83	87	2.6	8.5
TkA08G041920	`PF23244`	VWF	92	99	0.27	11.6
TkA08G041920	`PF23077`	zf-C2H2_ZNF462_1st	93	100	2.6	8.5
TkA08G041920	`PF23244`	VWF	104	109	0.27	11.6
TkA08G041920	`PF23077`	zf-C2H2_ZNF462_1st	105	113	2.6	8.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NM73`	Arabidopsis thaliana	sp\|Q6NM73\|PDLP2_ARATH Plasmodesmata-located protein 2	46.400%	Swiss-Prot	Medium
`O22784`	Arabidopsis thaliana	sp\|O22784\|PDLP3_ARATH Plasmodesmata-located protein 3	45.900%	Swiss-Prot	Medium
`Q8GXV7`	Arabidopsis thaliana	sp\|Q8GXV7\|PDLP1_ARATH Plasmodesmata-located protein 1	46.800%	Swiss-Prot	Medium
`Q9ZU94`	Arabidopsis thaliana	sp\|Q9ZU94\|PDLP6_ARATH Plasmodesmata-located protein 6	37.800%	Swiss-Prot	Medium
`Q9LV60`	Arabidopsis thaliana	sp\|Q9LV60\|CRR55_ARATH Cysteine-rich repeat secretory protein 55	34.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card