TkA08G041680 | RubberDandelionOmics

Gene overview

TkA08G041680

Reference: TK1151 Chr: Chr08 Coordinates: 10618777-10620061 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1032 bp · TkA08G041680|TK1151|cDNA

CAACATGGTCCTTCTAGCCCGCGTCTCTGCGTAACCCTCACGCCTCTTCAGCATTTATAAAGCCCCTCCCCGATTTTGATCTTACCCTCCCAATTTTTACTCAGCCTTGTCGATCTTCAACTACAATGGCTAGCAATGATCCCGAGCACAGAGAGGACGAGGAATCCGCTGCTGCCGAAGATGAAGACACCGGAGCGCAGGTTGCTCCAATCGTCAGGCTTGAAGCAGTCGACGTCACTACCGGTGAAGAAGACGAAGAT...

CDS

Download CDS FASTA

669 bp · TkA08G041680|TK1151|CDS

ATGGCTAGCAATGATCCCGAGCACAGAGAGGACGAGGAATCCGCTGCTGCCGAAGATGAAGACACCGGAGCGCAGGTTGCTCCAATCGTCAGGCTTGAAGCAGTCGACGTCACTACCGGTGAAGAAGACGAAGATGCAATGCTCAATCTGAAAGCGAAGTTGTATAGATTCGATAAGGACGGAAATCAGTGGAAGGAACGAGGTGCTGGGACTGTTAAGCTTCTAAAGCATAAAGAAACCGGAAAAGTTCGTCTCGTTAT...

Protein

Download Protein FASTA

222 aa · TkA08G041680|TK1151|PROTEIN

MASNDPEHREDEESAAAEDEDTGAQVAPIVRLEAVDVTTGEEDEDAMLNLKAKLYRFDKDGNQWKERGAGTVKLLKHKETGKVRLVMRQSKTLKICVNHFVIPTISVQEHAGNEKSCLWHASDFSDGELKDELFCIRFGSIDHCKKFMETVQDVADSQQPEKEENKDASNAAGLLENLTVEDKGEEVKKASADAPNEKEKEPEKVVESVEKKKEESLPASSS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G041680`
TK1151 ID	TkA08G041680
OH-1004 ID	LXL04_000643
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	84.100
Protein coverage (%)	TK1151 81.982 / OH-1004 83.333 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G041680

Location Chr08:10618777-10620061 (-)

Description Similar to RANBP1B: Ran-binding protein 1 homolog b

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g30060`	Ran-binding protein 1 homolog b.	No verified direct reference in this release
`At5g58590`	Ran-binding protein 1 homolog c.	No verified direct reference in this release
`At1g07140`	Ran-binding protein 1 homolog a.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000643 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006606 protein import into nucleus Biological Process

GO:0007051 spindle organization Biological Process

GO:0007165 signal transduction Biological Process

GO:0015031 protein transport Biological Process

GO:0046604 positive regulation of mitotic centrosome separation Biological Process

GO:0051028 mRNA transport Biological Process

GO:0051168 nuclear export Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005635 nuclear envelope Cellular Component

GO:0005643 nuclear pore Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G07140

ath:AT2G30060

ath:AT5G58590

hsa:5902

mmu:19385

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.662

Rank 1 · TkA08G041680 · TK1151

Nucleus0.279

Rank 2 · TkA08G041680 · TK1151

Cell membrane0.232

Rank 3 · TkA08G041680 · TK1151

Golgi apparatus0.097

Rank 4 · TkA08G041680 · TK1151

Endoplasmic reticulum0.074

Rank 5 · TkA08G041680 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00638Ran_BP136-154 aa

PF00568WH148-154 aa

PF28623UPF0508_C49-88 aa

PF22972EVH1_PP4R351-155 aa

PF22937PDXDC1-like_cen2122-159 aa

PF25349PH_PHS1125-162 aa

PF16228DUF4887152-218 aa

PF22972EVH1_PP4R3196-209 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G041680	`PF00638`	Ran_BP1	36	154	4e-39	134.4
TkA08G041680	`PF00568`	WH1	48	154	3.4e-05	24.5
TkA08G041680	`PF28623`	UPF0508_C	49	88	0.083	13.7
TkA08G041680	`PF22972`	EVH1_PP4R3	51	155	0.00017	22.8
TkA08G041680	`PF22937`	PDXDC1-like_cen2	122	159	0.058	14.2
TkA08G041680	`PF25349`	PH_PHS1	125	162	0.16	12.3
TkA08G041680	`PF16228`	DUF4887	152	218	0.14	13.0
TkA08G041680	`PF22972`	EVH1_PP4R3	196	209	0.00017	22.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RWG8`	Arabidopsis thaliana	sp\|Q8RWG8\|RBP1B_ARATH Ran-binding protein 1 homolog b	72.300%	Swiss-Prot	High
`P92985`	Arabidopsis thaliana	sp\|P92985\|RBP1C_ARATH Ran-binding protein 1 homolog c	74.300%	Swiss-Prot	High
`Q9LMK7`	Arabidopsis thaliana	sp\|Q9LMK7\|RBP1A_ARATH Ran-binding protein 1 homolog a	71.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card