TkA08G041390 | RubberDandelionOmics

Gene overview

TkA08G041390

Reference: TK1151 Chr: Chr08 Coordinates: 10543695-10544448 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

594 bp · TkA08G041390|TK1151|cDNA

CAGGTCTGTTATCTCCTCACTCATTTCACTAAAATTGTTTATTATAATTTTTTTTTTTAATTTTTAAAACAGTTGGGGAAGACAAAGGTATTTCTGAGGGCTGGTCAAATTGGAGTATTGGACAGTCAACGTGCAGGGGTATTGGATTCAGCTGCAAAGCGAATACAGCTTCGAATGAAAACATTCATTGCACACAAAGATTTCACATCAAAACGAAAAGCTGCAATCTCTTTTCAGGCATACTGCTGGGGGTATCTTGC...

CDS

Download CDS FASTA

420 bp · TkA08G041390|TK1151|CDS

ATGAAAACATTCATTGCACACAAAGATTTCACATCAAAACGAAAAGCTGCAATCTCTTTTCAGGCATACTGCTGGGGGTATCTTGCTAGAGCTGTATATGGTGCAAAACGTGAATGTGCAGCTGCTGTATTGATACAGAAGTACAGTCGTGGATGGATGTTGAAGAATACTTACACACAAAAATATCTATCTGCTGTACTCTTGCAAGCAAGTGTCCGTGGTTTTATTACCAGACAAAGATTCTTACACATAAGGGAACA...

Protein

Download Protein FASTA

140 aa · TkA08G041390|TK1151|PROTEIN

MKTFIAHKDFTSKRKAAISFQAYCWGYLARAVYGAKRECAAAVLIQKYSRGWMLKNTYTQKYLSAVLLQASVRGFITRQRFLHIREHTAATVIQARWRSYKIRSTFRTRVHDITKIQCFWRRKLAKRELRKLKQVRRHIK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G041390`
TK1151 ID	TkA08G041390
OH-1004 ID	LXL04_017906
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.500
Protein coverage (%)	TK1151 95.714 / OH-1004 9.197 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G041390`
Location	Chr08:10543695-10544448 (+)
Description	Similar to XI-I: Myosin-15
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_017906` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0007015 actin filament organization Biological Process GO:0007097 nuclear migration Biological Process GO:0009791 post-embryonic development Biological Process GO:0009826 unidimensional cell growth Biological Process GO:0009860 pollen tube growth Biological Process GO:0010090 trichome morphogenesis Biological Process GO:0010091 trichome branching Biological Process GO:0010154 fruit development Biological Process GO:0030048 actin filament-based movement Biological Process GO:0048467 gynoecium development Biological Process GO:0048767 root hair elongation Biological Process GO:0048768 root hair cell tip growth Biological Process
KEGG gene cross-reference	ath:AT1G08730 ath:AT1G54560 ath:AT4G33200 ath:AT5G20490 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.426

Rank 1 · TkA08G041390 · TK1151

Mitochondrion0.253

Rank 2 · TkA08G041390 · TK1151

Nucleus0.190

Rank 3 · TkA08G041390 · TK1151

Cell membrane0.064

Rank 4 · TkA08G041390 · TK1151

Plastid0.017

Rank 5 · TkA08G041390 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00612IQ14-33 aa

PF24609IQ_SCN5A_C36-59 aa

PF00612IQ41-58 aa

PF00612IQ64-81 aa

PF24609IQ_SCN5A_C85-105 aa

PF00612IQ88-107 aa

PF00612IQ113-130 aa

PF24609IQ_SCN5A_C116-133 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G041390	`PF00612`	IQ	14	33	2.7e-20	70.9
TkA08G041390	`PF24609`	IQ_SCN5A_C	36	59	0.014	15.6
TkA08G041390	`PF00612`	IQ	41	58	2.7e-20	70.9
TkA08G041390	`PF00612`	IQ	64	81	2.7e-20	70.9
TkA08G041390	`PF24609`	IQ_SCN5A_C	85	105	0.014	15.6
TkA08G041390	`PF00612`	IQ	88	107	2.7e-20	70.9
TkA08G041390	`PF00612`	IQ	113	130	2.7e-20	70.9
TkA08G041390	`PF24609`	IQ_SCN5A_C	116	133	0.014	15.6
TkA08G041390	`PF00612`	IQ	135	139	2.7e-20	70.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card