LXL04_017906 | RubberDandelionOmics

Gene overview

LXL04_017906

Reference: OH-1004 Chr: Chr04 Coordinates: 3330089-3337327 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4374 bp · LXL04_017906|LXL04_017906|OH1004|cDNA

ATGATGAGCAATAGCAACACTACGATGAGTCTCCGTAAGGGCTCCAAGGTGTGGTTGGAGGACAAAGACACAGCTTGGGCCGCTGGAGAAGTCAACAGTTTCGCCGGCAAACAGGTTCAAGTAATCACTGAATCCGGGAAACAGGTGTTGACTTTCGCATCAAAGCTGTTACTAAGAGATGGTGATGCAGAATATGGCGGGGTGGATAATATGACAAAGTTGGCTTACTTGAATGAACCAGGAGTGCTTGACTATATTAA...

CDS

Download CDS FASTA

4374 bp · LXL04_017906|LXL04_017906|OH1004|CDS

ATGATGAGCAATAGCAACACTACGATGAGTCTCCGTAAGGGCTCCAAGGTGTGGTTGGAGGACAAAGACACAGCTTGGGCCGCTGGAGAAGTCAACAGTTTCGCCGGCAAACAGGTTCAAGTAATCACTGAATCCGGGAAACAGGTGTTGACTTTCGCATCAAAGCTGTTACTAAGAGATGGTGATGCAGAATATGGCGGGGTGGATAATATGACAAAGTTGGCTTACTTGAATGAACCAGGAGTGCTTGACTATATTAA...

Protein

Download Protein FASTA

1457 aa · LXL04_017906|LXL04_017906|OH1004|PROTEIN

MMSNSNTTMSLRKGSKVWLEDKDTAWAAGEVNSFAGKQVQVITESGKQVLTFASKLLLRDGDAEYGGVDNMTKLAYLNEPGVLDYIKKRYALNEIYTYIGSILIAVNPFTKLPHLHNVHMMEQYNGAPFGELNPHVFAIADASYRAMINEGKSQSILVSGESGAGKTETTKLIMQYLTYVGGCPVTVTDDATVEQRLLESNPLLEAFGNAHTLRNDNSSRFGKFVEIQFDSNCRISGAAIRTYLLERSRVVQTTDSERNY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017906`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017906

Location Chr04:3330089-3337327 (-)

Description Similar to XI-I: Myosin-15

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g33200`	Myosin heavy chain that is required for the cell cycle- regulated transport of various organelles and proteins for their segregation.	Myosin XI-i links the nuclear membrane to the cytoskeleton to control nuclear movement and shape in Arabidopsis.2013 · DOI: 10.1016/j.cub.2013.07.035
`At1g54560`	Myosin heavy chain that is required for the cell cycle-regulated transport of various organelles and proteins for their segregation.	No verified direct reference in this release
`At5g20490`	Myosin heavy chain that is required for the cell cycle-regulated transport of various organelles and proteins for their segregation.	No verified direct reference in this release
`At1g08730`	Myosin heavy chain that is required for the cell cycle-regulated transport of various organelles and proteins for their segregation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017906 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007015 actin filament organization Biological Process

GO:0007097 nuclear migration Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0010090 trichome morphogenesis Biological Process

GO:0010091 trichome branching Biological Process

GO:0010154 fruit development Biological Process

GO:0030048 actin filament-based movement Biological Process

GO:0048467 gynoecium development Biological Process

GO:0048767 root hair elongation Biological Process

GO:0048768 root hair cell tip growth Biological Process

KEGG gene cross-reference

ath:AT1G08730

ath:AT1G54560

ath:AT4G33200

ath:AT5G20490

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.630

Rank 1 · LXL04_017906 · OH-1004

Cell membrane0.198

Rank 2 · LXL04_017906 · OH-1004

Nucleus0.194

Rank 3 · LXL04_017906 · OH-1004

Golgi apparatus0.101

Rank 4 · LXL04_017906 · OH-1004

Lysosome / Vacuole0.069

Rank 5 · LXL04_017906 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00063.28Myosin_head68-725 aa

PF01843.26DIL1276-1379 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017906	`PF00063.28`	Myosin_head	68	725	4e-237	789.5
LXL04_017906	`PF01843.26`	DIL	1276	1379	3.2e-26	92.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WPU1`	Arabidopsis thaliana	Myosin-15	65.209%	Swiss-Prot	strong database homology
`F4HWY6`	Arabidopsis thaliana	Myosin-11	50.850%	Swiss-Prot	strong database homology
`F4K5J1`	Arabidopsis thaliana	Myosin-17	50.856%	Swiss-Prot	strong database homology
`F4HXP9`	Arabidopsis thaliana	Myosin-9	50.197%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card