TkA08G040900 | RubberDandelionOmics

Gene overview

TkA08G040900

Reference: TK1151 Chr: Chr08 Coordinates: 10401970-10403156 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

855 bp · TkA08G040900|TK1151|cDNA

GTCGGGCACCTTCTTCCTTCATCTCCACCAACAGTAGAATTTAAGCCTCCAACAACCGCCACAACTCGCCGGAAAACGCAGCAATGATGCACATGACCTTCTACTGGGGCCCAAACGTCACTCTACTAATCGATTCATGGAAAACCGACTCATGGTTCAGTTACTTTCTCACCTTAATCGTCTGCTTCCTGGTTTCCGTCTTCTACCAGTTCATGGAAGACCGCCGCCTCCGATTCAAGCTCCTTTCAACCTCCACCGCC...

CDS

Download CDS FASTA

432 bp · TkA08G040900|TK1151|CDS

ATGATGCACATGACCTTCTACTGGGGCCCAAACGTCACTCTACTAATCGATTCATGGAAAACCGACTCATGGTTCAGTTACTTTCTCACCTTAATCGTCTGCTTCCTGGTTTCCGTCTTCTACCAGTTCATGGAAGACCGCCGCCTCCGATTCAAGCTCCTTTCAACCTCCACCGCCGCGATTGGTGACGTCGAGAATGTTCCGCTCTTGTACACCAAGTTTTTCTCTAACCGGAAACGAGCCAGGTTTGCCGGAACCGT...

Protein

Download Protein FASTA

143 aa · TkA08G040900|TK1151|PROTEIN

MMHMTFYWGPNVTLLIDSWKTDSWFSYFLTLIVCFLVSVFYQFMEDRRLRFKLLSTSTAAIGDVENVPLLYTKFFSNRKRARFAGTVLFGMNSAINYFLMLAVMSFNGGVFVVIVGGLAVGYLLFRSADDELIIVDEDPCACG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G040900`
TK1151 ID	TkA08G040900
OH-1004 ID	LXL04_028525
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	67.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G040900

Location Chr08:10401970-10403156 (-)

Description Similar to COPT5: Copper transporter 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g20650`	Involved in the transport of copper.	No verified direct reference in this release
`At2g26975`	Involved in the transport of copper.	No verified direct reference in this release
`At3g46900`	Involved in the transport of copper.	Identification of a copper transporter family in Arabidopsis thaliana.2003 · DOI: 10.1023/a:1022345507112

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0440700`	Involved in the transport of copper.	No verified direct reference in this release
`Os08g0455900`	Involved in the transport of copper.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028525 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006825 copper ion transport Biological Process

GO:0006952 defense response Biological Process

GO:0035434 copper ion transmembrane transport Biological Process

GO:0051604 protein maturation Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005770 late endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009536 plastid Cellular Component

GO:0005375 copper ion transmembrane transporter activity Molecular Function

GO:0051119 sugar transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT2G26975

ath:AT5G20650

ath:AT5G59040

dosa:Os01g0770700

dosa:Os09g0440700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.414

Rank 1 · TkA08G040900 · TK1151

Endoplasmic reticulum0.208

Rank 2 · TkA08G040900 · TK1151

Golgi apparatus0.173

Rank 3 · TkA08G040900 · TK1151

Cell membrane0.145

Rank 4 · TkA08G040900 · TK1151

Cytoplasm0.138

Rank 5 · TkA08G040900 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04145Ctr4-125 aa

PF14093DUF427119-52 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G040900	`PF04145`	Ctr	4	125	2.2e-20	74.5
TkA08G040900	`PF14093`	DUF4271	19	52	1.7	9.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93VM8`	Arabidopsis thaliana	sp\|Q93VM8\|COPT5_ARATH Copper transporter 5	51.400%	Swiss-Prot	High
`Q8GWP3`	Arabidopsis thaliana	sp\|Q8GWP3\|COPT6_ARATH Copper transporter 6	36.700%	Swiss-Prot	Medium
`Q9STG2`	Arabidopsis thaliana	sp\|Q9STG2\|COPT2_ARATH Copper transporter 2	36.200%	Swiss-Prot	Medium
`Q69P80`	Oryza sativa subsp. japonica	sp\|Q69P80\|COP51_ORYSJ Copper transporter 5.1	51.700%	Swiss-Prot	High
`Q6Z0Q9`	Oryza sativa subsp. japonica	sp\|Q6Z0Q9\|COP52_ORYSJ Putative copper transporter 5.2	37.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card