RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA08G036270
Reference: TK1151 Chr: Chr08 Coordinates: 9248733-9255224 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3091 bp · TkA08G036270|TK1151|cDNA

GTAATTATATGTTTTTATTTCTCATTTCTCTTCATGCCTAAATTGATACCATTTCTTTAAAAATGTTTAATTTATATTCTTTTCTTTGTATGCATTTGATAGAGGTTTCTGTTAGATGCTTGTCGCGATACAACATTGATCATTTTAATGGTAGCTGCTGCTGCTTCTTTGGCACTTGGTATAAAATCAGAGGGGATAAAAGAAGGGTGGTATGATGGTGGAAGCATAGCTTTGGCTGTTATAATTGTGATTGTCGTTAC...

CDS

Download CDS FASTA

3270 bp · TkA08G036270|TK1151|CDS

ATGAGTAGTGGTGGCTCACCCTACCGCCGACACCCGAAGGATTTGGAGTCCGGTGGTGGAAGCGGTGGAGGTTCTCAAGACTATGGGTCTGCTTGTGACCCTTTTGACATTGTTAGGACTAAAAGTGCATCAGTCGACAGTCTTAAAAGATGGAGGCAAGCGGCACTGGTGTTGAATGCTTCCCGTCGATTTCGCTACACCTTGGATTTGAAAAAGGAGGAAGAGAAGAAACAAATCATCGCAAAAATCAGAACTCATGC...

Protein

Download Protein FASTA

1089 aa · TkA08G036270|TK1151|PROTEIN

MSSGGSPYRRHPKDLESGGGSGGGSQDYGSACDPFDIVRTKSASVDSLKRWRQAALVLNASRRFRYTLDLKKEEEKKQIIAKIRTHAQVIRAAYLFQQHGEKTDGTPKVPPSPIPTGNYNVSPEQLASMTRDHDMSALQNFDGVKGLSEMLKTNPDKGIDDDESNILDRKNVFGSNTYPRKKGRSFWRFLLDACRDTTLIILMVAAAASLALGIKSEGIKEGWYDGGSIALAVIIVIVVTAISDYKQSLQFQNLNEEKQN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA08G036270
TK1151 IDTkA08G036270
OH-1004 IDLXL04_017966
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)99.800
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA08G036270
LocationChr08:9248733-9255224 (-)
DescriptionSimilar to ACA8: Calcium-transporting ATPase 8, plasma membrane-type
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g57110 This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol out of the cell. No verified direct reference in this release
At3g21180 This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol out of the cell or into organelles. No verified direct reference in this release
At4g29900 This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol into the endoplasmic reticulum. No verified direct reference in this release
At3g63380 This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol out of the cell or into organelles. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os04g0605500 This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol out of the cell, into the endoplasmic reticulum, or into organelles (By similarity). No verified direct reference in this release
Os12g0136900 This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol out of the cell, into the endoplasmic reticulum, or into organelles. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_017966 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009409 response to cold Biological Process
GO:0009414 response to water deprivation Biological Process
GO:0009555 pollen development Biological Process
GO:0009567 double fertilization forming a zygote and endosperm Biological Process
GO:0009624 response to nematode Biological Process
GO:0051480 regulation of cytosolic calcium ion concentration Biological Process
GO:0005634 nucleus Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0009506 plasmodesma Cellular Component
GO:0009536 plastid Cellular Component
GO:0016020 membrane Cellular Component
GO:0005388 P-type calcium transporter activity Molecular Function
KEGG gene cross-reference
ath:AT3G21180
ath:AT3G63380
ath:AT4G29900
ath:AT5G57110
dosa:Os04g0605500
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.634
Rank 1 · TkA08G036270 · TK1151
Endoplasmic reticulum0.147
Rank 2 · TkA08G036270 · TK1151
Lysosome / Vacuole0.126
Rank 3 · TkA08G036270 · TK1151
Cytoplasm0.111
Rank 4 · TkA08G036270 · TK1151
Golgi apparatus0.088
Rank 5 · TkA08G036270 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12515CaATP_NAI33-75 aa
PF00690Cation_ATPase_N143-209 aa
PF00689Cation_ATPase_C203-242 aa
PF00122E1-E2_ATPase262-358 aa
PF00689Cation_ATPase_C377-426 aa
PF00702Hydrolase482-808 aa
PF13246Cation_ATPase524-697 aa
PF08282Hydrolase_3700-730 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA08G036270PF12515CaATP_NAI33754.4e-1762.0
TkA08G036270PF00690Cation_ATPase_N1432093.9e-1349.5
TkA08G036270PF00689Cation_ATPase_C2032427.3e-43147.1
TkA08G036270PF00122E1-E2_ATPase2623587e-2071.5
TkA08G036270PF00689Cation_ATPase_C3774267.3e-43147.1
TkA08G036270PF00702Hydrolase4828081.9e-1455.2
TkA08G036270PF13246Cation_ATPase5246979.9e-36123.9
TkA08G036270PF08282Hydrolase_37007300.002218.5
TkA08G036270PF08282Hydrolase_37888400.002218.5
TkA08G036270PF00689Cation_ATPase_C87910557.3e-43147.1
TkA08G036270PF00702Hydrolase9419831.9e-1455.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LF79Arabidopsis thalianasp|Q9LF79|ACA8_ARATH Calcium-transporting ATPase 8, plasma membrane-type72.400%Swiss-ProtHigh
Q9LU41Arabidopsis thalianasp|Q9LU41|ACA9_ARATH Calcium-transporting ATPase 9, plasma membrane-type72.600%Swiss-ProtHigh
Q9SZR1Arabidopsis thalianasp|Q9SZR1|ACA10_ARATH Calcium-transporting ATPase 10, plasma membrane-type72.200%Swiss-ProtHigh
Q9LY77Arabidopsis thalianasp|Q9LY77|ACA12_ARATH Calcium-transporting ATPase 12, plasma membrane-type52.100%Swiss-ProtHigh
Q7X8B5Oryza sativa subsp. japonicasp|Q7X8B5|ACA5_ORYSJ Calcium-transporting ATPase 5, plasma membrane-type72.500%Swiss-ProtHigh
Q2QY12Oryza sativa subsp. japonicasp|Q2QY12|ACA9_ORYSJ Probable calcium-transporting ATPase 9, plasma membrane-type49.300%Swiss-ProtMedium

JBrowse

View in Genome Browser