RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA08G034990
Reference: TK1151 Chr: Chr08 Coordinates: 8952892-8954847 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

766 bp · TkA08G034990|TK1151|cDNA

GTCGGTTCATTTTTCAAACAGATCTCACTTTGACGGCCGAAGTTCAACCAGCAATCGGAATCGCTGCAAAACCAGTTCCGAAAATGGCCAGATCCGCTGCCGTACCTTTCATTTTCACGATCCTGCTAACGATCGGCGCCTTCTATATGTCCAATGCAGAAGCATCATCCGCCGATTTCGTGAAGAAGACCGTCTCCTCTCACCCCATAGTCATCTTCTCCAAATCATACTGCCCATACTGTAAAAGGGCTAAAGGTATA...

CDS

Download CDS FASTA

402 bp · TkA08G034990|TK1151|CDS

ATGGCCAGATCCGCTGCCGTACCTTTCATTTTCACGATCCTGCTAACGATCGGCGCCTTCTATATGTCCAATGCAGAAGCATCATCCGCCGATTTCGTGAAGAAGACCGTCTCCTCTCACCCCATAGTCATCTTCTCCAAATCATACTGCCCATACTGTAAAAGGGCTAAAGGTATATTCAACGAGTTGAATCAGAAACCTTATGTTGTTGAGTTGGATCAGAGAGAGGATGGAGCGAATATTCAGAATGCTATGGGCGA...

Protein

Download Protein FASTA

133 aa · TkA08G034990|TK1151|PROTEIN

MARSAAVPFIFTILLTIGAFYMSNAEASSADFVKKTVSSHPIVIFSKSYCPYCKRAKGIFNELNQKPYVVELDQREDGANIQNAMGEFVGKRTVPQVFVNGKHLGGSDDTMEAYESGELAKLLGISSSYETEL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA08G034990
TK1151 IDTkA08G034990
OH-1004 IDLXL04_017986
Relationship / confidenceSequence Supported Annotation Or Model Conflict / Review
Protein identity (%)100.000
Protein coverage (%)TK1151 100.000 / OH-1004 53.200
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA08G034990
LocationChr08:8952892-8954847 (-)
DescriptionSimilar to GRXC4: Glutaredoxin-C4
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g20500 Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. No verified direct reference in this release
At1g77370 Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os06g0659500 Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. No verified direct reference in this release
Os02g0646400 May only reduce GSH-thiol disulfides, but not protein disulfides. No verified direct reference in this release
Os04g0508300 Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase.
Cloning and sequence analysis of a cDNA encoding rice glutaredoxin.1994 · DOI: 10.1016/0014-5793(94)80264-5
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_017986 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0034599 cellular response to oxidative stress Biological Process
GO:0000137 Golgi cis cisterna Cellular Component
GO:0005576 extracellular region Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0005773 vacuole Cellular Component
GO:0005783 endoplasmic reticulum Cellular Component
GO:0005789 endoplasmic reticulum membrane Cellular Component
GO:0005794 Golgi apparatus Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0009536 plastid Cellular Component
GO:0099503 secretory vesicle Cellular Component
GO:0015038 glutathione disulfide oxidoreductase activity Molecular Function
KEGG gene cross-reference
ath:AT1G77370
ath:AT5G20500
dosa:Os02g0646400
dosa:Os04g0508300
dosa:Os06g0659500
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.495
Rank 1 · TkA08G034990 · TK1151
Golgi apparatus0.164
Rank 2 · TkA08G034990 · TK1151
Endoplasmic reticulum0.159
Rank 3 · TkA08G034990 · TK1151
Extracellular0.137
Rank 4 · TkA08G034990 · TK1151
Cytoplasm0.137
Rank 5 · TkA08G034990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26981Thioredoxin-like_PDI17-72 aa
PF13728TraF25-66 aa
PF00085Thioredoxin33-68 aa
PF13462Thioredoxin_438-65 aa
PF00462Glutaredoxin42-103 aa
PF05768Glrx-like42-75 aa
PF01323DSBA42-73 aa
PF13098Thioredoxin_242-69 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA08G034990PF26981Thioredoxin-like_PDI17720.006917.0
TkA08G034990PF13728TraF25660.03414.7
TkA08G034990PF00085Thioredoxin33680.03914.7
TkA08G034990PF13462Thioredoxin_438650.1213.3
TkA08G034990PF00462Glutaredoxin421031e-1971.2
TkA08G034990PF05768Glrx-like42750.02215.8
TkA08G034990PF01323DSBA42730.02215.3
TkA08G034990PF13098Thioredoxin_242690.03515.1
TkA08G034990PF13192Thioredoxin_3431030.01416.1
TkA08G034990PF13417GST_N_3471090.0008120.4
TkA08G034990PF13409GST_N_2491150.0002922.1
TkA08G034990PF13462Thioredoxin_4821080.1213.3
TkA08G034990PF01323DSBA941090.02215.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q8LFQ6Arabidopsis thalianasp|Q8LFQ6|GRXC4_ARATH Glutaredoxin-C466.200%Swiss-ProtHigh
Q9FVX1Arabidopsis thalianasp|Q9FVX1|GRXC3_ARATH Glutaredoxin-C362.500%Swiss-ProtHigh
Q0DAE4Oryza sativa subsp. japonicasp|Q0DAE4|GRXC8_ORYSJ Glutaredoxin-C869.500%Swiss-ProtHigh
Q6H628Oryza sativa subsp. japonicasp|Q6H628|GRXS6_ORYSJ Monothiol glutaredoxin-S652.000%Swiss-ProtHigh
P55142Oryza sativa subsp. japonicasp|P55142|GRXC6_ORYSJ Glutaredoxin-C648.000%Swiss-ProtMedium

JBrowse

View in Genome Browser