LXL04_017986 | RubberDandelionOmics

Gene overview

LXL04_017986

Reference: OH-1004 Chr: Chr04 Coordinates: 4660767-4664490 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

753 bp · LXL04_017986|LXL04_017986|OH1004|cDNA

ATGCGGGACAGCTCCTACTCCGACATTCCTCCTCCTGCTCCGACGTGTTCTTCCGGTGGACTACGTCTTCTTGAGGTGACGACCCTTCTTCCTCCGACTCGACGTCCCTTCTTCCTCCGATCTGCCACTCCTCGGGCGAGCAGAGGCACCACAATGTGGACGATTAATGCTCATCTGATTTTAAGTCCGACACGCCTGATTTTTAGTAGGTTGACTGATTTTTCATCTGTTTTGACTGAGTTTAACTCTATTTATAACAA...

CDS

Download CDS FASTA

753 bp · LXL04_017986|LXL04_017986|OH1004|CDS

ATGCGGGACAGCTCCTACTCCGACATTCCTCCTCCTGCTCCGACGTGTTCTTCCGGTGGACTACGTCTTCTTGAGGTGACGACCCTTCTTCCTCCGACTCGACGTCCCTTCTTCCTCCGATCTGCCACTCCTCGGGCGAGCAGAGGCACCACAATGTGGACGATTAATGCTCATCTGATTTTAAGTCCGACACGCCTGATTTTTAGTAGGTTGACTGATTTTTCATCTGTTTTGACTGAGTTTAACTCTATTTATAACAA...

Protein

Download Protein FASTA

250 aa · LXL04_017986|LXL04_017986|OH1004|PROTEIN

MRDSSYSDIPPPAPTCSSGGLRLLEVTTLLPPTRRPFFLRSATPRASRGTTMWTINAHLILSPTRLIFSRLTDFSSVLTEFNSIYNKRCSRFIFQTDLTLTAEVQPAIGIAAKPVPKMARSAAVPFIFTILLTIGAFYMSNAEASSADFVKKTVSSHPIVIFSKSYCPYCKRAKGIFNELNQKPYVVELDQREDGANIQNAMGEFVGKRTVPQVFVNGKHLGGSDDTMEAYESGELAKLLGISSSYETEL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017986`
TK1151 ID	TkA08G034990
OH-1004 ID	LXL04_017986
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 53.200 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017986

Location Chr04:4660767-4664490 (+)

Description Similar to GRXC4: Glutaredoxin-C4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g20500`	Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase.	No verified direct reference in this release
`At1g77370`	Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0659500`	Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase.	No verified direct reference in this release
`Os02g0646400`	May only reduce GSH-thiol disulfides, but not protein disulfides.	No verified direct reference in this release
`Os04g0508300`	Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase.	Cloning and sequence analysis of a cDNA encoding rice glutaredoxin.1994 · DOI: 10.1016/0014-5793(94)80264-5

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017986 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0034599 cellular response to oxidative stress Biological Process

GO:0000137 Golgi cis cisterna Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0099503 secretory vesicle Cellular Component

GO:0015038 glutathione disulfide oxidoreductase activity Molecular Function

KEGG gene cross-reference

ath:AT1G77370

ath:AT5G20500

dosa:Os02g0646400

dosa:Os04g0508300

dosa:Os06g0659500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.211

Rank 1 · LXL04_017986 · OH-1004

Golgi apparatus0.158

Rank 2 · LXL04_017986 · OH-1004

Cytoplasm0.140

Rank 3 · LXL04_017986 · OH-1004

Extracellular0.138

Rank 4 · LXL04_017986 · OH-1004

Plastid0.138

Rank 5 · LXL04_017986 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00462.31Glutaredoxin159-220 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017986	`PF00462.31`	Glutaredoxin	159	220	3.5e-19	69.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LFQ6`	Arabidopsis thaliana	Glutaredoxin-C4	66.165%	Swiss-Prot	moderate database homology
`Q9FVX1`	Arabidopsis thaliana	Glutaredoxin-C3	56.198%	Swiss-Prot	weak database homology
`Q0DAE4`	Oryza sativa subsp. japonica	Glutaredoxin-C8	71.569%	Swiss-Prot	weak database homology
`Q6H628`	Oryza sativa subsp. japonica	Monothiol glutaredoxin-S6	51.639%	Swiss-Prot	weak database homology
`P55142`	Oryza sativa subsp. japonica	Glutaredoxin-C6	47.115%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card