TkA08G034940 | RubberDandelionOmics

Gene overview

TkA08G034940

Reference: TK1151 Chr: Chr08 Coordinates: 8928920-8933511 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1251 bp · TkA08G034940|TK1151|cDNA

ATGAAGCATCACACATTGGGCGTATTCTTGATCATCGGGGGGTTAATCTTGTTCCTAATTTTGCTGATTATTATATTTGCCTTCCGAAAATCAATCCAAACATATCAGCTAGGGAAGTGTGTAAAACGTAAAGACAGCTGTAAAGCCGCAAAAGACTATTTTACCGGGAAACTCCAGTCAATTAGCTATTTTAGTTTTCGAACATTAAAGGAAGCATCTAAGAATTTTGACGAACGTAATCTTCTTGGGGAAGGTGGATT...

CDS

Download CDS FASTA

1251 bp · TkA08G034940|TK1151|CDS

ATGAAGCATCACACATTGGGCGTATTCTTGATCATCGGGGGGTTAATCTTGTTCCTAATTTTGCTGATTATTATATTTGCCTTCCGAAAATCAATCCAAACATATCAGCTAGGGAAGTGTGTAAAACGTAAAGACAGCTGTAAAGCCGCAAAAGACTATTTTACCGGGAAACTCCAGTCAATTAGCTATTTTAGTTTTCGAACATTAAAGGAAGCATCTAAGAATTTTGACGAACGTAATCTTCTTGGGGAAGGTGGATT...

Protein

Download Protein FASTA

416 aa · TkA08G034940|TK1151|PROTEIN

MKHHTLGVFLIIGGLILFLILLIIIFAFRKSIQTYQLGKCVKRKDSCKAAKDYFTGKLQSISYFSFRTLKEASKNFDERNLLGEGGFGPVYLGKLQDGRLVAIKKLSLKKSQQGEEEFLAEVRMITSIQHKNLLRLLGCCSEGPQRVLVYEYMKNRSLDLIIYGKSNEYLNWNMRFQIILGIARGLQYLHEESHIRIVHRDIKASNILLDGNFQPRIGDFGLARFFPENQAYLSATLAGTLGYTAPEYAIRGELSEKADI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G034940`
TK1151 ID	TkA08G034940
OH-1004 ID	LXL04_017988
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.000
Protein coverage (%)	TK1151 99.760 / OH-1004 95.814 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G034940

Location Chr08:8928920-8933511 (-)

Description Similar to At1g56140: Probable LRR receptor-like serine/threonine-protein kinase At1g56140

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g56140`	Probable LRR receptor-like serine/threonine-protein kinase At1g56140.	No verified direct reference in this release
`At1g56130`	Probable LRR receptor-like serine/threonine-protein kinase At1g56130.	No verified direct reference in this release
`At1g16670`	Negative regulator of freezing tolerance that phosphorylates 14-3-3 proteins (e.g. GRF6) thus triggering their translocation from the cytosol to the nucleus in response to cold stress.	No verified direct reference in this release
`At1g07650`	Probable LRR receptor-like serine/threonine-protein kinase At1g07650.	No verified direct reference in this release
`At1g53440`	Probable LRR receptor-like serine/threonine-protein kinase At1g53440.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017988 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002237 response to molecule of bacterial origin Biological Process

GO:0009409 response to cold Biological Process

GO:0009625 response to insect Biological Process

GO:0031667 response to nutrient levels Biological Process

GO:0045088 regulation of innate immune response Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0050826 response to freezing Biological Process

GO:0052542 defense response by callose deposition Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G07650

ath:AT1G16670

ath:AT1G53430

ath:AT1G56130

ath:AT1G56140

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.763

Rank 1 · TkA08G034940 · TK1151

Cytoplasm0.155

Rank 2 · TkA08G034940 · TK1151

Nucleus0.095

Rank 3 · TkA08G034940 · TK1151

Endoplasmic reticulum0.081

Rank 4 · TkA08G034940 · TK1151

Golgi apparatus0.037

Rank 5 · TkA08G034940 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase78-278 aa

PF07714PK_Tyr_Ser-Thr80-347 aa

PF03109ABC182-104 aa

PF03109ABC1145-231 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G034940	`PF00069`	Pkinase	78	278	4.9e-44	151.4
TkA08G034940	`PF07714`	PK_Tyr_Ser-Thr	80	347	1.5e-46	159.5
TkA08G034940	`PF03109`	ABC1	82	104	0.0017	18.3
TkA08G034940	`PF03109`	ABC1	145	231	0.0017	18.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`C0LGH3`	Arabidopsis thaliana	sp\|C0LGH3\|Y5614_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g56140	50.000%	Swiss-Prot	High
`C0LGH2`	Arabidopsis thaliana	sp\|C0LGH2\|Y1561_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g56130	50.200%	Swiss-Prot	High
`Q93YN1`	Arabidopsis thaliana	sp\|Q93YN1\|CRPK1_ARATH Cold-responsive protein kinase 1	48.800%	Swiss-Prot	Medium
`C0LGE0`	Arabidopsis thaliana	sp\|C0LGE0\|Y1765_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g07650	46.000%	Swiss-Prot	Medium
`C0LGG9`	Arabidopsis thaliana	sp\|C0LGG9\|Y5344_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g53440	48.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card