TkA08G033200 | RubberDandelionOmics

Gene overview

TkA08G033200

Reference: TK1151 Chr: Chr08 Coordinates: 8445136-8449462 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1075 bp · TkA08G033200|TK1151|cDNA

CTTTTTCAGTCGGCTTTGATTGCTTTAGCTGCCCATGCTTCTGACCCCACTGAAGCCGAACGACTCAAGTTTCTTGCATCTCCAGCTGGCAAGGATGAATACTCTCAATGGATAGTTTCAAGTCAAAGAAGTCTTCTAGAAGTAATGGAAGCTTTCCCTTCAGCCAAACCGCCACTTGGCGTCTTCTTTGCTGCTGTTGCCCCTCGCTTACAGCCTCGTTACTACTCCATTTCCTCCTCGCCAAAGTTTGCACCTACAAG...

CDS

Download CDS FASTA

2109 bp · TkA08G033200|TK1151|CDS

ATGCAATCTGAATCCGTGGAAACATCGCTGTTTGATTTGTTGACCGCAGCTCTCAAGGGGAAACTTATAGGCAGTGTTAACGGATCGGATAGCGGAGACTCAACGATGCCGCTGGCTTTGGCGACGATTTTGGAAAATCGTGAGCTCTTGGTGATACTGACAACGTCAGTTGCTGTTTTGGTAGGATGTTTTGTTGTTCTGGTGTGGAAAAGATCTGGGAAGAAGTCGGTTAAGGAATTGGAGCCACCGAAGATCGTTGT...

Protein

Download Protein FASTA

702 aa · TkA08G033200|TK1151|PROTEIN

MQSESVETSLFDLLTAALKGKLIGSVNGSDSGDSTMPLALATILENRELLVILTTSVAVLVGCFVVLVWKRSGKKSVKELEPPKIVVPKRQLEEEVDDGKKKVTIFFGTQTGTAEGFAKALFEEAKVRYEKASFKVIDLDDYAADDDEYEQKLKKESFAFFFLATYGDGEPTDNAARFYKWFTEGEEKAQFNKLHYGVFGLGNRQYEHFNKIAKVVDDGLADQGAKRLVPVGLGDDDQSIEDDFSAWKELVWPELDQLLR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G033200`
TK1151 ID	TkA08G033200
OH-1004 ID	LXL04_018020
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G033200

Location Chr08:8445136-8449462 (-)

Description Similar to CPR: NADPH--cytochrome P450 reductase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g30210`	This enzyme is required for electron transfer from NADP to cytochrome P450 in microsomes.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0653400`	This enzyme is required for electron transfer from NADP to cytochrome P450 in microsomes (By similarity).	Rice P450 reductases differentially affect P450-mediated metabolism in bacterial expression systems.2013 · DOI: 10.1007/s00449-012-0787-0
`Os08g0243500`	This enzyme is required for electron transfer from NADP to cytochrome P450 in microsomes (By similarity).	Rice P450 reductases differentially affect P450-mediated metabolism in bacterial expression systems.2013 · DOI: 10.1007/s00449-012-0787-0
`Os09g0558900`	This enzyme is required for electron transfer from NADP to cytochrome P450 in microsomes (By similarity).	Rice P450 reductases differentially affect P450-mediated metabolism in bacterial expression systems.2013 · DOI: 10.1007/s00449-012-0787-0

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018020 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009698 phenylpropanoid metabolic process Biological Process

GO:0051762 sesquiterpene biosynthetic process Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003958 NADPH-hemoprotein reductase activity Molecular Function

GO:0010181 FMN binding Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

GO:0050660 flavin adenine dinucleotide binding Molecular Function

GO:0050661 NADP binding Molecular Function

KEGG gene cross-reference

ath:AT4G30210

dosa:Os09g0558900

osa:4347838

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.371

Rank 1 · TkA08G033200 · TK1151

Cytoplasm0.316

Rank 2 · TkA08G033200 · TK1151

Mitochondrion0.181

Rank 3 · TkA08G033200 · TK1151

Nucleus0.144

Rank 4 · TkA08G033200 · TK1151

Golgi apparatus0.133

Rank 5 · TkA08G033200 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00175NAD_binding_197-152 aa

PF02550AcetylCoA_hydro100-156 aa

PF00258Flavodoxin_1105-247 aa

PF00175NAD_binding_1257-318 aa

PF00667FAD_binding_1303-524 aa

PF00175NAD_binding_1556-666 aa

PF02550AcetylCoA_hydro635-688 aa

PF00258Flavodoxin_1654-670 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G033200	`PF00175`	NAD_binding_1	97	152	1.5e-17	64.9
TkA08G033200	`PF02550`	AcetylCoA_hydro	100	156	0.058	13.7
TkA08G033200	`PF00258`	Flavodoxin_1	105	247	2.9e-31	109.2
TkA08G033200	`PF00175`	NAD_binding_1	257	318	1.5e-17	64.9
TkA08G033200	`PF00667`	FAD_binding_1	303	524	3.2e-70	236.9
TkA08G033200	`PF00175`	NAD_binding_1	556	666	1.5e-17	64.9
TkA08G033200	`PF02550`	AcetylCoA_hydro	635	688	0.058	13.7
TkA08G033200	`PF00258`	Flavodoxin_1	654	670	2.9e-31	109.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SUM3`	Arabidopsis thaliana	sp\|Q9SUM3\|NCPR2_ARATH NADPH--cytochrome P450 reductase 2	72.300%	Swiss-Prot	High
`Q7X7K8`	Oryza sativa subsp. japonica	sp\|Q7X7K8\|NCPR1_ORYSJ NADPH--cytochrome P450 reductase 1	79.500%	Swiss-Prot	High
`Q0J705`	Oryza sativa subsp. japonica	sp\|Q0J705\|NCPR2_ORYSJ NADPH--cytochrome P450 reductase 2	79.900%	Swiss-Prot	High
`Q653S9`	Oryza sativa subsp. japonica	sp\|Q653S9\|NCPR3_ORYSJ NADPH--cytochrome P450 reductase 3	79.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card