RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA08G027980
Reference: TK1151 Chr: Chr08 Coordinates: 7212294-7213730 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1258 bp · TkA08G027980|TK1151|cDNA

GTCGTTTTTGTAAAATTATCCCTCACACCGAGAGTACAAAATGCTCGTCAGCCAGCCTTGCTATCAGCAAACGGCGTTGCCTTCCTCTCTTTCCTTGATTTTCTATCTCTAAAATATTCTGATACGAAACCCTTTTTTGCTTTCGAAATTCCCACTTGGACTCACTTTTTCTTCATCTTTTCATCAATTCATCAGCCAAAAGTTTCTACACTTTTCAGAAGATCATTGAAAAAAGCAAGCAACCATGGTGCGTGTGAGCA...

CDS

Download CDS FASTA

810 bp · TkA08G027980|TK1151|CDS

ATGGTGCGTGTGAGCAACAACTTAGTCGGCATCCTCAATTTCGTAACGTTCCTCCTCTCAATCCCCATCTTGGCCGGCGGTATTTGGCTATCACGTCAAGGAACCTCCGAATGCGAACGATTCCTTGATAGACCAGTCATCGCGCTCGGGATCTTCCTCATGATCGTCTCACTCGCCGGCCTCATCGGCGCGTGTTGTCGCGTGTCGTGGCTCCTATGGGTGTACCTACTCGTGATGTTTCTACTAATCCTCCTCCTTTT...

Protein

Download Protein FASTA

269 aa · TkA08G027980|TK1151|PROTEIN

MVRVSNNLVGILNFVTFLLSIPILAGGIWLSRQGTSECERFLDRPVIALGIFLMIVSLAGLIGACCRVSWLLWVYLLVMFLLILLLFCFTIFAFVVTNKGAGNTVSGRGYKEYRLGDYSDWLQKRVNSDKNWNKIKSCLQDSKVCKSLIDDGSDNAPVDVFYSRHLSSIQSGCCKPANDCNFTYVTPTNWTKTPTTSGNTDCGAWDNDQNTLCFNCQSCKAGLLDNIKSDWKKVAVLNVIFLVFLIVVYSIGCCAFRNNR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA08G027980
TK1151 IDTkA08G027980
OH-1004 IDLXL04_005200
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)46.300
Protein coverage (%)TK1151 98.885 / OH-1004 66.998
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA08G027980
LocationChr08:7212294-7213730 (+)
DescriptionSimilar to TET3: Tetraspanin-3
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At2g23810 May be involved in the regulation of cell differentiation. No verified direct reference in this release
At4g28050 May be involved in the regulation of cell differentiation. No verified direct reference in this release
At4g30430 May be involved in the regulation of cell differentiation. No verified direct reference in this release
At5g46700 Involved in the basipetal transport of auxin (IAA) that modulates growth and organs organization, as well as cell differentiation.
Tornado1 and tornado2 are required for the specification of radial and circumferential pattern in the Arabidopsis root.2000 · DOI: 10.1242/dev.127.15.3385
The ekeko mutant demonstrates a role for tetraspanin-like protein in plant development.2003 · DOI: 10.1016/j.bbrc.2003.09.122
The TORNADO1 and TORNADO2 genes function in several patterning processes during early leaf development in Arabidopsis thaliana.2006 · DOI: 10.1105/tpc.105.040568
Mutations in the TORNADO2 gene affect cellular decisions in the peripheral zone of the shoot apical meristem of Arabidopsis thaliana.2007 · DOI: 10.1007/s11103-006-9105-z
Arabidopsis WIH1 and WIH2 genes act in the transition from somatic to reproductive cell fate.2011 · DOI: 10.1016/j.cub.2011.05.015
At3g45600 May be involved in the regulation of cell differentiation. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_005200 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum Biological Process
GO:0009734 auxin-activated signaling pathway Biological Process
GO:0050829 defense response to Gram-negative bacterium Biological Process
GO:0090110 COPII-coated vesicle cargo loading Biological Process
GO:0099039 sphingolipid translocation Biological Process
GO:0005576 extracellular region Cellular Component
GO:0005773 vacuole Cellular Component
GO:0005794 Golgi apparatus Cellular Component
GO:0005829 cytosol Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0009506 plasmodesma Cellular Component
GO:0070062 extracellular exosome Cellular Component
KEGG gene cross-reference
ath:AT2G23810
ath:AT3G45600
ath:AT4G28050
ath:AT4G30430
ath:AT5G60220
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.803
Rank 1 · TkA08G027980 · TK1151
Cytoplasm0.126
Rank 2 · TkA08G027980 · TK1151
Lysosome / Vacuole0.093
Rank 3 · TkA08G027980 · TK1151
Endoplasmic reticulum0.055
Rank 4 · TkA08G027980 · TK1151
Golgi apparatus0.040
Rank 5 · TkA08G027980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00335Tetraspanin6-255 aa
PF09685MamF_MmsF12-100 aa
PF19747DUF623428-89 aa
PF11770GAPT46-65 aa
PF01284MARVEL46-101 aa
PF20990DUF2207_C47-134 aa
PF08592Anthrone_oxy48-100 aa
PF19261DUF590449-71 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA08G027980PF00335Tetraspanin62557.3e-41141.0
TkA08G027980PF09685MamF_MmsF121000.01616.3
TkA08G027980PF19747DUF623428890.005617.8
TkA08G027980PF11770GAPT46650.8410.1
TkA08G027980PF01284MARVEL461011.99.2
TkA08G027980PF20990DUF2207_C471340.04414.2
TkA08G027980PF08592Anthrone_oxy481000.007217.2
TkA08G027980PF19261DUF590449710.3911.5
TkA08G027980PF28043KwaA55990.7310.4
TkA08G027980PF06024Orf7871990.8610.7
TkA08G027980PF16492Cadherin_C_274970.09614.1
TkA08G027980PF11770GAPT77880.8410.1
TkA08G027980PF25184YxzE781540.2113.3
TkA08G027980PF11770GAPT1221380.8410.1
TkA08G027980PF25184YxzE1972030.2113.3
TkA08G027980PF19261DUF59042272580.3911.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q8S8Q6Arabidopsis thalianasp|Q8S8Q6|TET8_ARATH Tetraspanin-864.900%Swiss-ProtHigh
Q9SUD4Arabidopsis thalianasp|Q9SUD4|TET7_ARATH Tetraspanin-760.400%Swiss-ProtHigh
Q9M0B7Arabidopsis thalianasp|Q9M0B7|TET9_ARATH Tetraspanin-958.000%Swiss-ProtHigh
Q9FIQ5Arabidopsis thalianasp|Q9FIQ5|TRN2_ARATH Protein TORNADO 246.200%Swiss-ProtMedium
Q9M1E7Arabidopsis thalianasp|Q9M1E7|TET3_ARATH Tetraspanin-349.200%Swiss-ProtMedium

JBrowse

View in Genome Browser