TkA08G025830 | RubberDandelionOmics

Gene overview

TkA08G025830

Reference: TK1151 Chr: Chr08 Coordinates: 6588559-6598584 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1383 bp · TkA08G025830|TK1151|cDNA

ATGAATGCTGCTACTCAACCGGCTAAAACACTGAAGCCTTTACATTGGTTAAAGTTAGATATAGTAGGACAAGGAAGCTTGTGGGCTGAAGCAGAAAAATCTGGTGATGCTGGAAGTGAACCAGAGATTGATATGTTGGAACTTGAAACACTCTTTTCAATGTTAAATCCAAATGCTGGCAAGGCATCAAAAGTAAAATCTCAAGCAGCTAATAAACCCGAAAACATACAACTGATTGGTCATAGACGGTCATATAACTG...

CDS

Download CDS FASTA

1383 bp · TkA08G025830|TK1151|CDS

ATGAATGCTGCTACTCAACCGGCTAAAACACTGAAGCCTTTACATTGGTTAAAGTTAGATATAGTAGGACAAGGAAGCTTGTGGGCTGAAGCAGAAAAATCTGGTGATGCTGGAAGTGAACCAGAGATTGATATGTTGGAACTTGAAACACTCTTTTCAATGTTAAATCCAAATGCTGGCAAGGCATCAAAAGTAAAATCTCAAGCAGCTAATAAACCCGAAAACATACAACTGATTGGTCATAGACGGTCATATAACTG...

Protein

Download Protein FASTA

460 aa · TkA08G025830|TK1151|PROTEIN

MNAATQPAKTLKPLHWLKLDIVGQGSLWAEAEKSGDAGSEPEIDMLELETLFSMLNPNAGKASKVKSQAANKPENIQLIGHRRSYNCEIVLSKVTTPLPELMEQVLNLDDSAMDMEQVEKLIKFCPTKKEMELLNNYKEEHEMLGKCEQFYLELMKVPRAEEKLVVFSYKLQFSAELSELRHNLEAVYLSVEQIRSSVKLRRVMQTILSLGNALNQGTTRGAAVGFKMHSLLKVTETRASGNKMTLMHYLCKVLADKLPE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G025830`
TK1151 ID	TkA08G025830
OH-1004 ID	LXL04_018128
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	89.200
Protein coverage (%)	TK1151 87.826 / OH-1004 38.069 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G025830

Location Chr08:6588559-6598584 (+)

Description Similar to FH13: Formin-like protein 13

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g58160`	Formin-like protein 13.	No verified direct reference in this release
`At2g25050`	Formin-like protein 18.	No verified direct reference in this release
`At3g32400`	Formin-like protein 17.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0280200`	Formin-like protein 6.	No verified direct reference in this release
`Os02g0794900`	Formin-like protein 7.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018128 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0015630 microtubule cytoskeleton Cellular Component

GO:0090406 pollen tube Cellular Component

GO:0003779 actin binding Molecular Function

GO:0004721 phosphoprotein phosphatase activity Molecular Function

KEGG gene cross-reference

ath:AT2G25050

ath:AT3G32400

ath:AT5G58160

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.674

Rank 1 · TkA08G025830 · TK1151

Cell membrane0.276

Rank 2 · TkA08G025830 · TK1151

Nucleus0.151

Rank 3 · TkA08G025830 · TK1151

Golgi apparatus0.082

Rank 4 · TkA08G025830 · TK1151

Endoplasmic reticulum0.040

Rank 5 · TkA08G025830 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02181FH25-373 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G025830	`PF02181`	FH2	5	373	6e-103	345.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LVN1`	Arabidopsis thaliana	sp\|Q9LVN1\|FH13_ARATH Formin-like protein 13	58.300%	Swiss-Prot	High
`Q9SK28`	Arabidopsis thaliana	sp\|Q9SK28\|FH18_ARATH Formin-like protein 18	55.800%	Swiss-Prot	High
`Q9LH02`	Arabidopsis thaliana	sp\|Q9LH02\|FH17_ARATH Formin-like protein 17	53.800%	Swiss-Prot	High
`Q6ZCX3`	Oryza sativa subsp. japonica	sp\|Q6ZCX3\|FH6_ORYSJ Formin-like protein 6	55.200%	Swiss-Prot	High
`Q6K8Z4`	Oryza sativa subsp. japonica	sp\|Q6K8Z4\|FH7_ORYSJ Formin-like protein 7	56.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card