LXL04_018128 | RubberDandelionOmics

Gene overview

LXL04_018128

Reference: OH-1004 Chr: Chr04 Coordinates: 7009242-7019579 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3297 bp · LXL04_018128|LXL04_018128|OH1004|cDNA

ATGAAGCTTCTTTTCTCCGAAATGAATGCTGCTACTCAACCGGCTAAAACACTGAAGCCTTTACATTGGTTAAAGTTAGATATAGTAGGACAAGGAAGCTTGTGGGCTGAAGCAGAAAAATCTGGTGATGCTGGAAGgtgttTGCCCGCATCGTGGACCGATGAAGAGAAGAAGATTAAAGATCTTAAGGCTTTATCCCAtattcgtttgcacttgtcaaacaatgccttggattcaaaagagaagatgaagcatattac...

CDS

Download CDS FASTA

3297 bp · LXL04_018128|LXL04_018128|OH1004|CDS

ATGAAGCTTCTTTTCTCCGAAATGAATGCTGCTACTCAACCGGCTAAAACACTGAAGCCTTTACATTGGTTAAAGTTAGATATAGTAGGACAAGGAAGCTTGTGGGCTGAAGCAGAAAAATCTGGTGATGCTGGAAGGTGTTTGCCCGCATCGTGGACCGATGAAGAGAAGAAGATTAAAGATCTTAAGGCTTTATCCCATATTCGTTTGCACTTGTCAAACAATGCCTTGGATTCAAAAGAGAAGATGAAGCATATTAC...

Protein

Download Protein FASTA

1098 aa · LXL04_018128|LXL04_018128|OH1004|PROTEIN

MKLLFSEMNAATQPAKTLKPLHWLKLDIVGQGSLWAEAEKSGDAGRCLPASWTDEEKKIKDLKALSHIRLHLSNNALDSKEKMKHITGSRDASAEGLQARGYKASGRGRYPQPSSEANSKSEGRRKFCNYCQKKGHEIEDCFKLRNKIAEKDKLDGHNHASASGESDVAEPGLLKKSEVSIIVRMNNGEVRRLVRSGRRPYSSTLGSLAHATVSMVFYGEDLEISNTGYLNKSYSLDILISEPEIDMLELETLFSMLNPN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018128`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018128

Location Chr04:7009242-7019579 (-)

Description Similar to FH13: Formin-like protein 13

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g58160`	Formin-like protein 13.	No verified direct reference in this release
`At2g25050`	Formin-like protein 18.	No verified direct reference in this release
`At3g32400`	Formin-like protein 17.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0280200`	Formin-like protein 6.	No verified direct reference in this release
`Os02g0794900`	Formin-like protein 7.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018128 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0015630 microtubule cytoskeleton Cellular Component

GO:0090406 pollen tube Cellular Component

GO:0003779 actin binding Molecular Function

GO:0004721 phosphoprotein phosphatase activity Molecular Function

KEGG gene cross-reference

ath:AT2G25050

ath:AT3G32400

ath:AT5G58160

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.725

Rank 1 · LXL04_018128 · OH-1004

Nucleus0.205

Rank 2 · LXL04_018128 · OH-1004

Cell membrane0.190

Rank 3 · LXL04_018128 · OH-1004

Mitochondrion0.053

Rank 4 · LXL04_018128 · OH-1004

Golgi apparatus0.053

Rank 5 · LXL04_018128 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02181.29FH2244-305 aa

PF02181.29FH2303-343 aa

PF02181.29FH2356-516 aa

PF02181.29FH2679-1062 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018128	`PF02181.29`	FH2	244	305	1.8e-159	531.6
LXL04_018128	`PF02181.29`	FH2	303	343	1.8e-159	531.6
LXL04_018128	`PF02181.29`	FH2	356	516	1.8e-159	531.6
LXL04_018128	`PF02181.29`	FH2	679	1062	1.8e-159	531.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LVN1`	Arabidopsis thaliana	Formin-like protein 13	57.466%	Swiss-Prot	weak database homology
`Q9SK28`	Arabidopsis thaliana	Formin-like protein 18	57.933%	Swiss-Prot	weak database homology
`Q9LH02`	Arabidopsis thaliana	Formin-like protein 17	56.250%	Swiss-Prot	weak database homology
`Q6ZCX3`	Oryza sativa subsp. japonica	Formin-like protein 6	54.670%	Swiss-Prot	weak database homology
`Q6K8Z4`	Oryza sativa subsp. japonica	Formin-like protein 7	56.479%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card