TkA08G023860 | RubberDandelionOmics

Gene overview

TkA08G023860

Reference: TK1151 Chr: Chr08 Coordinates: 6058103-6059207 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1002 bp · TkA08G023860|TK1151|cDNA

TAGGAATTCACCTTGTCACGCTTATCAACACCTCTTTCCTTATATAATCTCCAAAATCCATTCTCCTTCAACTCATCTTCTTCTTAGTTCTTACAGTCATCAAAAGAGAATCCCAGAACCATGGCCAAGAAAGAAATGGAAGTTGTAAAAGGCGTCGATCTACAACGATACATGGGAAGATGGTACGAAATAGCTTCATTCCCGACGTTTTTTCAGCCCAAAACCGGCACCAACACAAGGGCTACATACACACTGAAGGA...

CDS

Download CDS FASTA

567 bp · TkA08G023860|TK1151|CDS

ATGGCCAAGAAAGAAATGGAAGTTGTAAAAGGCGTCGATCTACAACGATACATGGGAAGATGGTACGAAATAGCTTCATTCCCGACGTTTTTTCAGCCCAAAACCGGCACCAACACAAGGGCTACATACACACTGAAGGACGATGGCGCTACTGTTAATGTTCTGAATGAAACTTGGAGTAATGGGAAGAGAGATTCCATTGAAGGTATTGCTTATAAAGCAGATCCCAAAAACGATGAAGCGAAATTCAAGGTGAAATT...

Protein

Download Protein FASTA

188 aa · TkA08G023860|TK1151|PROTEIN

MAKKEMEVVKGVDLQRYMGRWYEIASFPTFFQPKTGTNTRATYTLKDDGATVNVLNETWSNGKRDSIEGIAYKADPKNDEAKFKVKFYVPPFLPIIPVTGNYWILYLDDDYQYALIGEPSKKSLWILCRQTHMDDEVYNMLVEKAKEEGYADAMTKLKKTPQADPPPESDAAPADTKGVWWFKSLFGK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G023860`
TK1151 ID	TkA08G023860
OH-1004 ID	LXL04_018147
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 95.213 / OH-1004 33.210 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G023860

Location Chr08:6058103-6059207 (-)

Description Similar to TIL: Temperature-induced lipocalin-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g58070`	Involved in basal (BT) and acquired thermotolerance (AT), probably by preventing plasma membrane lipids peroxidation induced by severe heat-shock (HS).	Temperature-induced lipocalin is required for basal and acquired thermotolerance in Arabidopsis.2009 · DOI: 10.1111/j.1365-3040.2009.01972.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018147 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000302 response to reactive oxygen species Biological Process

GO:0006629 lipid metabolic process Biological Process

GO:0006883 intracellular sodium ion homeostasis Biological Process

GO:0006950 response to stress Biological Process

GO:0009408 response to heat Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009644 response to high light intensity Biological Process

GO:0010286 heat acclimation Biological Process

GO:0010431 seed maturation Biological Process

GO:0030644 intracellular chloride ion homeostasis Biological Process

KEGG gene cross-reference

ath:AT5G58070

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.348

Rank 1 · TkA08G023860 · TK1151

Cell membrane0.232

Rank 2 · TkA08G023860 · TK1151

Mitochondrion0.216

Rank 3 · TkA08G023860 · TK1151

Endoplasmic reticulum0.152

Rank 4 · TkA08G023860 · TK1151

Plastid0.140

Rank 5 · TkA08G023860 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08212Lipocalin_212-162 aa

PF00061Lipocalin19-150 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G023860	`PF08212`	Lipocalin_2	12	162	2.7e-49	167.6
TkA08G023860	`PF00061`	Lipocalin	19	150	2.2e-05	25.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FGT8`	Arabidopsis thaliana	sp\|Q9FGT8\|TIL_ARATH Temperature-induced lipocalin-1	73.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card