TkA08G023160 | RubberDandelionOmics

Gene overview

TkA08G023160

Reference: TK1151 Chr: Chr08 Coordinates: 5867426-5869485 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1644 bp · TkA08G023160|TK1151|cDNA

CGCTACTCTTCCCTTCCCGCTACAACTGAGCTCTCTCTCGCTGTAGAAATGGCGTCTGAGAAACTCACAGAGTACGAGCGCAAACGCCTGGAGAACATCAAGCGCAACCGTGAACAGCTTGAAGCTCTCAACATCCACTCCAAGCTTGCCGATCTGTCTGCCTCCGCCGAACGCCACAGGGAAGAGACTACATATTACAGAATTAATCCATATATGAAAGCAAAATCCGAAACCCCAGTTGTAAGCCGCAAATCTCTAAG...

CDS

Download CDS FASTA

1392 bp · TkA08G023160|TK1151|CDS

ATGGCGTCTGAGAAACTCACAGAGTACGAGCGCAAACGCCTGGAGAACATCAAGCGCAACCGTGAACAGCTTGAAGCTCTCAACATCCACTCCAAGCTTGCCGATCTGTCTGCCTCCGCCGAACGCCACAGGGAAGAGACTACATATTACAGAATTAATCCATATATGAAAGCAAAATCCGAAACCCCAGTTGTAAGCCGCAAATCTCTAAGAACCCGAGGAATAAAGCCAGAGTTTAGACAAATACCTTACACAAAAAC...

Protein

Download Protein FASTA

463 aa · TkA08G023160|TK1151|PROTEIN

MASEKLTEYERKRLENIKRNREQLEALNIHSKLADLSASAERHREETTYYRINPYMKAKSETPVVSRKSLRTRGIKPEFRQIPYTKTKNVMPDKSPRELTFLSMRDVSISSKPDEPLVKKILSVDRRKGATKSVECRVRASIDIESMELMPENIARVVRDRILSVKFFPSADMRMVVVGNRLGDLGFWNVDSKNEDGDGDGIYMYRPHSGAITSICIQPFAINKITTCCQHGFIRTLDIEKETFDLTYHSEDPIFCMSQR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G023160`
TK1151 ID	TkA08G023160
OH-1004 ID	LXL04_018157
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.300
Protein coverage (%)	TK1151 98.920 / OH-1004 43.371 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G023160`
Location	Chr08:5867426-5869485 (-)
Description	Similar to wdr76: WD repeat-containing protein 76
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_018157` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006974 DNA damage response Biological Process GO:2000001 regulation of DNA damage checkpoint Biological Process GO:0000792 heterochromatin Cellular Component GO:0005634 nucleus Cellular Component GO:0090734 site of DNA damage Cellular Component GO:0003677 DNA binding Molecular Function GO:0019899 enzyme binding Molecular Function
KEGG gene cross-reference	hsa:79968 mmu:241627 xla:735144 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.888

Rank 1 · TkA08G023160 · TK1151

Cytoplasm0.157

Rank 2 · TkA08G023160 · TK1151

Cell membrane0.021

Rank 3 · TkA08G023160 · TK1151

Mitochondrion0.018

Rank 4 · TkA08G023160 · TK1151

Endoplasmic reticulum0.010

Rank 5 · TkA08G023160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25172Beta-prop_WDR3_2nd156-235 aa

PF23409Beta-prop_EML157-277 aa

PF24796WDR55158-326 aa

PF24807WD40_CDC20-Fz159-361 aa

PF23215WD_LRWD1159-205 aa

PF23381Beta-prop_IFT122_1st160-193 aa

PF24814WD40_Prp19160-408 aa

PF24817WD40_WDHD1_1st160-194 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G023160	`PF25172`	Beta-prop_WDR3_2nd	156	235	1.5e-07	31.7
TkA08G023160	`PF23409`	Beta-prop_EML	157	277	1.4e-06	28.7
TkA08G023160	`PF24796`	WDR55	158	326	3.4e-10	40.2
TkA08G023160	`PF24807`	WD40_CDC20-Fz	159	361	4e-15	56.6
TkA08G023160	`PF23215`	WD_LRWD1	159	205	0.0022	17.7
TkA08G023160	`PF23381`	Beta-prop_IFT122_1st	160	193	2.2e-15	57.4
TkA08G023160	`PF24814`	WD40_Prp19	160	408	3.8e-15	56.4
TkA08G023160	`PF24817`	WD40_WDHD1_1st	160	194	5.7e-08	33.0
TkA08G023160	`PF23381`	Beta-prop_IFT122_1st	161	326	2.2e-15	57.4
TkA08G023160	`PF25171`	Beta-prop_WDR36-Utp21_1st	162	193	3e-11	44.0
TkA08G023160	`PF24805`	EIF3I	164	192	9.2e-08	32.3
TkA08G023160	`PF23775`	Beta-prop_RIG_2nd	170	353	1.5e-09	38.4
TkA08G023160	`PF13570`	Beta-prop_ACSF4	170	292	0.0053	16.9
TkA08G023160	`PF23414`	Beta-prop_EML_2	171	215	1.7e-10	41.5
TkA08G023160	`PF25168`	Beta-prop_WDR36-Utp21_2nd	175	368	1.5e-07	31.7
TkA08G023160	`PF25047`	Beta-prop_TEP1_2nd	175	194	0.00044	20.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card