TkA08G018530 | RubberDandelionOmics

Gene overview

TkA08G018530

Reference: TK1151 Chr: Chr08 Coordinates: 4592708-4598162 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3614 bp · TkA08G018530|TK1151|cDNA

ATGCTCTGGTTAACGTGTAAATGGGGCTAAGCCGTTCGTCGCAATGAATTTCTAAATCGATATCTACTTGATACGGAAACAATCTTCCCACAGAGAAACCGGAGTGGTTATTGATCTCTCGCAGAACTAGATCTGTAATCTCTCAGTATGAAAACAATCTGCGCAAGGAAAAATGAGAGCACGTATTCATCTTCCGTAAAACTAGGGAATTGAGCTTTGTTTACAAACATAGAACATAAACTCGGTGTTAAAAATGGCAT...

CDS

Download CDS FASTA

1554 bp · TkA08G018530|TK1151|CDS

ATGGCATGGTTAAGAGCTGGATCTACTGTAGCAAAACTCGCAATTAGGAGAACTGTAACACATGGCCGATCATACGCATCAAGACCACGCCTCCTTCCATCATCACACCACTCTCTCCACACCACAATCCCCAAATCAAAACCAGAACCCTCACCCATCCCTCGATCAGTCCCACTTTCCAAATTATCAGACAACTTCTTAGATGGAACCAGCAGTGTCTACCTGGAAGAAATGCAAAGAGCCTGGGAGGCCGACCCCAC...

Protein

Download Protein FASTA

517 aa · TkA08G018530|TK1151|PROTEIN

MAWLRAGSTVAKLAIRRTVTHGRSYASRPRLLPSSHHSLHTTIPKSKPEPSPIPRSVPLSKLSDNFLDGTSSVYLEEMQRAWEADPTSVDESWDNFFKNFVGQSAMSPSVSGQTIQESMRLLLLVRAYQVHGHMKAELDPLSLEQRDIPHDLDPNFYGFTESDLDREFFLGVWKMSGFLSENRPVQTLRAILTRLEQAYCGSIGYEYMHIANRDHCNWLRERIETPTPTQYSTKRREVILDRLIWGTQFENFLATKWTAA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G018530`
TK1151 ID	TkA08G018530
OH-1004 ID	LXL04_018247
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 94.004 / OH-1004 47.600 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G018530`
Location	Chr08:4592708-4598162 (-)
Description	Similar to ogdh: 2-oxoglutarate dehydrogenase, mitochondrial
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_018247` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006091 generation of precursor metabolites and energy Biological Process GO:0006096 glycolytic process Biological Process GO:0006099 tricarboxylic acid cycle Biological Process GO:0006103 2-oxoglutarate metabolic process Biological Process GO:0006457 protein folding Biological Process GO:0045333 cellular respiration Biological Process GO:0005739 mitochondrion Cellular Component GO:0005759 mitochondrial matrix Cellular Component GO:0031966 mitochondrial membrane Cellular Component GO:0042645 mitochondrial nucleoid Cellular Component GO:0045252 oxoglutarate dehydrogenase complex Cellular Component GO:0004591 oxoglutarate dehydrogenase (succinyl-transferring) activity Molecular Function
KEGG gene cross-reference	cel:CELE_T22B11.5 ddi:DDB_G0288127 sce:YIL125W spo:2540991 vda:VDAG_10018 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.905

Rank 1 · TkA08G018530 · TK1151

Cytoplasm0.078

Rank 2 · TkA08G018530 · TK1151

Nucleus0.061

Rank 3 · TkA08G018530 · TK1151

Peroxisome0.024

Rank 4 · TkA08G018530 · TK1151

Cell membrane0.016

Rank 5 · TkA08G018530 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF160782-oxogl_dehyd_N64-101 aa

PF02274ADI213-309 aa

PF00676E1_dh247-486 aa

PF25441Hexapep_UGP3_C378-421 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G018530	`PF16078`	2-oxogl_dehyd_N	64	101	5.7e-15	55.3
TkA08G018530	`PF02274`	ADI	213	309	0.019	14.7
TkA08G018530	`PF00676`	E1_dh	247	486	4.3e-37	128.4
TkA08G018530	`PF25441`	Hexapep_UGP3_C	378	421	0.16	12.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card