RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA08G017450
Reference: TK1151 Chr: Chr08 Coordinates: 4335154-4338822 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2193 bp · TkA08G017450|TK1151|cDNA

GAAGTAGAGTGTAGTTGTGGTGTTAATCGAATAATCGATTAATCGTATAAAGGTCAACTTTTGCCTATGTTTTTCCCCTGAAAAGCTGATAGCCTTTCTTATTTATTTTCCACATTGAGTTCTCGTGTCTCTTTCTTTTTCACGACGCGCCGTAGTTGACTCAGTTGTGTACTCGTTGGAGTTCCAGAAGATCCGATCACCGGGTTCCCTCTCCGCCGCCATTCCGGCAACCCGTTTTTTCTCTCCATCGGATGAACGAG...

CDS

Download CDS FASTA

1347 bp · TkA08G017450|TK1151|CDS

ATGATGAACAGAGTGACAAAGAAGGTCGGGAAATATGAAATTGGCCGAACACTTGGTGAAGGCACATTTGCAAAGGTCAAGTTTGCAAAAAATACAGAGACTGGTGAAGGTGTTGCTGTTAAGGTTCTGGCTAAAAGCACAATACTGAAGCATAAAATGGTGGACCAGATTAAAAGAGAGATCTCCATTATGAAGATAGTGAGGCATCCTAATATTGTGAGACTGCACGAGGTTTTATCAAGCCAAACAAAGATATATAT...

Protein

Download Protein FASTA

448 aa · TkA08G017450|TK1151|PROTEIN

MMNRVTKKVGKYEIGRTLGEGTFAKVKFAKNTETGEGVAVKVLAKSTILKHKMVDQIKREISIMKIVRHPNIVRLHEVLSSQTKIYIILEFVTGGELFDRIVHKGKLSEKEAREYFQQLIDAVSHCHSKGVYHRDLKPENLLLDSNERLKVSDFGLSALPQQGVELLYTTCGTPNYIAPEVLKRHGYDGGAADIWSCGVILYVLLTGYLPFEESDLPTLYKKVNAADFSYPFWFPSGAKSLLDKILDPNPQTRIGIDGIR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA08G017450
TK1151 IDTkA08G017450
OH-1004 IDLXL04_018244
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)100.000
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA08G017450
LocationChr08:4335154-4338822 (+)
DescriptionSimilar to CIPK24: CBL-interacting serine/threonine-protein kinase 24
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g35410 May regulate intracellular Na⁺/K⁺ homeostasis and salt tolerance.
The Arabidopsis SOS2 protein kinase physically interacts with and is activated by the calcium-binding protein SOS3.2000 · DOI: 10.1073/pnas.97.7.3735
Regulation of SOS1, a plasma membrane Na+/H+ exchanger in Arabidopsis thaliana, by SOS2 and SOS3.2002 · DOI: 10.1073/pnas.122224699
The protein kinase SOS2 activates the Arabidopsis H(+)/Ca(2+) antiporter CAX1 to integrate calcium transport and salt tolerance.2004 · DOI: 10.1074/jbc.m309084200
At4g24400 CIPK serine-threonine protein kinases interact with CBL proteins. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os06g0606000 May regulate intracellular Na⁺/K⁺ homeostasis and salt tolerance.
Conservation of the salt overly sensitive pathway in rice.2007 · DOI: 10.1104/pp.106.092635
Os01g0536000 CIPK serine-threonine protein kinases interact with CBL proteins. No verified direct reference in this release
Os12g0132200 CIPK serine-threonine protein kinases interact with CBL proteins. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_018244 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006468 protein phosphorylation Biological Process
GO:0007165 signal transduction Biological Process
GO:0007584 response to nutrient Biological Process
GO:0009414 response to water deprivation Biological Process
GO:0009651 response to salt stress Biological Process
GO:0009749 response to glucose Biological Process
GO:0010118 stomatal movement Biological Process
GO:0010119 regulation of stomatal movement Biological Process
GO:0010167 response to nitrate Biological Process
GO:0046777 protein autophosphorylation Biological Process
GO:0048364 root development Biological Process
GO:1990573 potassium ion import across plasma membrane Biological Process
KEGG gene cross-reference
ath:AT1G30270
ath:AT4G24400
ath:AT5G35410
dosa:Os01g0536000
dosa:Os06g0606000
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.529
Rank 1 · TkA08G017450 · TK1151
Nucleus0.381
Rank 2 · TkA08G017450 · TK1151
Cell membrane0.250
Rank 3 · TkA08G017450 · TK1151
Golgi apparatus0.056
Rank 4 · TkA08G017450 · TK1151
Lysosome / Vacuole0.055
Rank 5 · TkA08G017450 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase12-265 aa
PF07714PK_Tyr_Ser-Thr13-259 aa
PF14531Kinase-like16-61 aa
PF03109ABC123-65 aa
PF00216Bac_DNA_binding26-60 aa
PF01636APH56-127 aa
PF02149KA160-75 aa
PF12330Haspin_kinase78-171 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA08G017450PF00069Pkinase122651.4e-75254.8
TkA08G017450PF07714PK_Tyr_Ser-Thr132592.4e-37129.4
TkA08G017450PF14531Kinase-like16616.8e-0626.3
TkA08G017450PF03109ABC123653.4e-0523.8
TkA08G017450PF00216Bac_DNA_binding26600.2412.4
TkA08G017450PF01636APH561270.01615.7
TkA08G017450PF02149KA160750.2211.9
TkA08G017450PF12330Haspin_kinase781710.005816.4
TkA08G017450PF03109ABC1821623.4e-0523.8
TkA08G017450PF06293Kdo871470.009116.2
TkA08G017450PF00216Bac_DNA_binding951290.2412.4
TkA08G017450PF14531Kinase-like1092136.8e-0626.3
TkA08G017450PF01636APH1291490.01615.7
TkA08G017450PF00216Bac_DNA_binding2762990.2412.4
TkA08G017450PF03822NAF3093671.5e-1867.3
TkA08G017450PF14531Kinase-like3123346.8e-0626.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LDI3Arabidopsis thalianasp|Q9LDI3|CIPKO_ARATH CBL-interacting serine/threonine-protein kinase 2470.900%Swiss-ProtHigh
Q9STV4Arabidopsis thalianasp|Q9STV4|CIPK8_ARATH CBL-interacting serine/threonine-protein kinase 863.000%Swiss-ProtHigh
Q69Q47Oryza sativa subsp. japonicasp|Q69Q47|CIPKO_ORYSJ CBL-interacting protein kinase 2468.800%Swiss-ProtHigh
Q5JLD8Oryza sativa subsp. japonicasp|Q5JLD8|CIPK8_ORYSJ CBL-interacting protein kinase 863.500%Swiss-ProtHigh
Q2QY53Oryza sativa subsp. japonicasp|Q2QY53|CIPKW_ORYSJ CBL-interacting protein kinase 3259.400%Swiss-ProtHigh

JBrowse

View in Genome Browser