LXL04_018244 | RubberDandelionOmics

Gene overview

LXL04_018244

Reference: OH-1004 Chr: Chr04 Coordinates: 9448754-9451400 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1347 bp · LXL04_018244|LXL04_018244|OH1004|cDNA

ATGATGAACAGAGTGACAAAGAAGGTCGGGAAATATGAAATTGGCCGAACACTTGGTGAAGGCACATTTGCAAAGGTCAAGTTTGCAAAAAATACAGAGACTGGTGAAGGTGTTGCTGTTAAGGTTCTGGCTAAAAGCACAATACTGAAGCATAAAATGGTGGACCAGATTAAAAGAGAGATCTCCATTATGAAGATAGTGAGGCATCCTAATATTGTGAGACTGCACGAGGTTTTATCAAGCCAAACAAAGATATATAT...

CDS

Download CDS FASTA

1347 bp · LXL04_018244|LXL04_018244|OH1004|CDS

ATGATGAACAGAGTGACAAAGAAGGTCGGGAAATATGAAATTGGCCGAACACTTGGTGAAGGCACATTTGCAAAGGTCAAGTTTGCAAAAAATACAGAGACTGGTGAAGGTGTTGCTGTTAAGGTTCTGGCTAAAAGCACAATACTGAAGCATAAAATGGTGGACCAGATTAAAAGAGAGATCTCCATTATGAAGATAGTGAGGCATCCTAATATTGTGAGACTGCACGAGGTTTTATCAAGCCAAACAAAGATATATAT...

Protein

Download Protein FASTA

448 aa · LXL04_018244|LXL04_018244|OH1004|PROTEIN

MMNRVTKKVGKYEIGRTLGEGTFAKVKFAKNTETGEGVAVKVLAKSTILKHKMVDQIKREISIMKIVRHPNIVRLHEVLSSQTKIYIILEFVTGGELFDRIVHKGKLSEKEAREYFQQLIDAVSHCHSKGVYHRDLKPENLLLDSNERLKVSDFGLSALPQQGVELLYTTCGTPNYIAPEVLKRHGYDGGAADIWSCGVILYVLLTGYLPFEESDLPTLYKKVNAADFSYPFWFPSGAKSLLDKILDPNPQTRIGIDGIR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018244`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018244

Location Chr04:9448754-9451400 (+)

Description Similar to CIPK24: CBL-interacting serine/threonine-protein kinase 24

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g35410`	May regulate intracellular Na⁺/K⁺ homeostasis and salt tolerance.	The Arabidopsis SOS2 protein kinase physically interacts with and is activated by the calcium-binding protein SOS3.2000 · DOI: 10.1073/pnas.97.7.3735 Regulation of SOS1, a plasma membrane Na+/H+ exchanger in Arabidopsis thaliana, by SOS2 and SOS3.2002 · DOI: 10.1073/pnas.122224699 The protein kinase SOS2 activates the Arabidopsis H(+)/Ca(2+) antiporter CAX1 to integrate calcium transport and salt tolerance.2004 · DOI: 10.1074/jbc.m309084200
`At4g24400`	CIPK serine-threonine protein kinases interact with CBL proteins.	No verified direct reference in this release
`At1g30270`	CIPK serine-threonine protein kinases interact with CBL proteins.	A protein kinase, interacting with two calcineurin B-like proteins, regulates K+ transporter AKT1 in Arabidopsis.2006 · DOI: 10.1016/j.cell.2006.06.011 A Ca(2)+ signaling pathway regulates a K(+) channel for low-K response in Arabidopsis.2006 · DOI: 10.1073/pnas.0605129103 A protein phosphorylation/dephosphorylation network regulates a plant potassium channel.2007 · DOI: 10.1073/pnas.0707912104 Two calcineurin B-like calcium sensors, interacting with protein kinase CIPK23, regulate leaf transpiration and root potassium uptake in Arabidopsis.2007 · DOI: 10.1111/j.1365-313x.2007.03236.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0606000`	May regulate intracellular Na⁺/K⁺ homeostasis and salt tolerance.	Conservation of the salt overly sensitive pathway in rice.2007 · DOI: 10.1104/pp.106.092635
`Os01g0536000`	CIPK serine-threonine protein kinases interact with CBL proteins.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018244 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0007165 signal transduction Biological Process

GO:0007584 response to nutrient Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009749 response to glucose Biological Process

GO:0010118 stomatal movement Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0010167 response to nitrate Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0048364 root development Biological Process

GO:1990573 potassium ion import across plasma membrane Biological Process

KEGG gene cross-reference

ath:AT1G30270

ath:AT4G24400

ath:AT5G35410

dosa:Os01g0536000

dosa:Os06g0606000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.529

Rank 1 · LXL04_018244 · OH-1004

Nucleus0.381

Rank 2 · LXL04_018244 · OH-1004

Cell membrane0.250

Rank 3 · LXL04_018244 · OH-1004

Golgi apparatus0.056

Rank 4 · LXL04_018244 · OH-1004

Lysosome / Vacuole0.055

Rank 5 · LXL04_018244 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase12-265 aa

PF07714.24PK_Tyr_Ser-Thr13-259 aa

PF14531.13Kinase-like109-213 aa

PF03822.21NAF309-367 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018244	`PF00069.32`	Pkinase	12	265	1.4e-75	254.8
LXL04_018244	`PF07714.24`	PK_Tyr_Ser-Thr	13	259	2.4e-37	129.4
LXL04_018244	`PF14531.13`	Kinase-like	109	213	6.8e-06	26.3
LXL04_018244	`PF03822.21`	NAF	309	367	1.5e-18	67.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LDI3`	Arabidopsis thaliana	CBL-interacting serine/threonine-protein kinase 24	70.852%	Swiss-Prot	strong database homology
`Q9STV4`	Arabidopsis thaliana	CBL-interacting serine/threonine-protein kinase 8	62.980%	Swiss-Prot	strong database homology
`Q93VD3`	Arabidopsis thaliana	CBL-interacting serine/threonine-protein kinase 23	58.782%	Swiss-Prot	strong database homology
`Q69Q47`	Oryza sativa subsp. japonica	CBL-interacting protein kinase 24	68.778%	Swiss-Prot	strong database homology
`Q5JLD8`	Oryza sativa subsp. japonica	CBL-interacting protein kinase 8	63.529%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card