TkA08G017260 | RubberDandelionOmics

Gene overview

TkA08G017260

Reference: TK1151 Chr: Chr08 Coordinates: 4297939-4298250 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

312 bp · TkA08G017260|TK1151|cDNA

ATGCGCAATGAAAAGGAATATTTTGAGAAGATTTTGATTGAACGTTTGAAGGAATATGTTGAATTTGATCAGCAACAACAAGGTCGTGTATCTGATGATGATGTGGTGAAATTAGATAACGCATGGCGATCTGGGGTTGTGCATCTAGTGGGTGAGCATGAGATTGTTTCGAGACAAGGGTCTTCAATCAGGAAGAAGTTCTTGATTGATTATGCTTACAATTTCATGAAGAAGAACTTGAGGCAAAGCTATAATGTGTT...

CDS

Download CDS FASTA

312 bp · TkA08G017260|TK1151|CDS

ATGCGCAATGAAAAGGAATATTTTGAGAAGATTTTGATTGAACGTTTGAAGGAATATGTTGAATTTGATCAGCAACAACAAGGTCGTGTATCTGATGATGATGTGGTGAAATTAGATAACGCATGGCGATCTGGGGTTGTGCATCTAGTGGGTGAGCATGAGATTGTTTCGAGACAAGGGTCTTCAATCAGGAAGAAGTTCTTGATTGATTATGCTTACAATTTCATGAAGAAGAACTTGAGGCAAAGCTATAATGTGTT...

Protein

Download Protein FASTA

103 aa · TkA08G017260|TK1151|PROTEIN

MRNEKEYFEKILIERLKEYVEFDQQQQGRVSDDDVVKLDNAWRSGVVHLVGEHEIVSRQGSSIRKKFLIDYAYNFMKKNLRQSYNVFEIPHKRMLKVGMTYEL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G017260`
TK1151 ID	TkA08G017260
OH-1004 ID	LXL04_037049
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	87.300
Protein coverage (%)	TK1151 93.204 / OH-1004 12.863 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G017260

Location Chr08:4297939-4298250 (+)

Description Similar to POT5: Potassium transporter 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g13420`	High-affinity potassium transporter.	High-affinity K(+) transport in Arabidopsis: AtHAK5 and AKT1 are vital for seedling establishment and postgermination growth under low-potassium conditions.2010 · DOI: 10.1104/pp.110.154369 The CBL-Interacting Protein Kinase CIPK23 Regulates HAK5-Mediated High-Affinity K+ Uptake in Arabidopsis Roots.2015 · DOI: 10.1104/pp.15.01401

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0930400`	High-affinity potassium transporter.	Rice sodium-insensitive potassium transporter, OsHAK5, confers increased salt tolerance in tobacco BY2 cells.2011 · DOI: 10.1016/j.jbiosc.2010.10.014 The role of a potassium transporter OsHAK5 in potassium acquisition and transport from roots to shoots in rice at low potassium supply levels.2014 · DOI: 10.1104/pp.114.246520 Overexpression of OsHAK5 potassium transporter enhances virus resistance in rice (Oryza sativa).2022 · DOI: 10.1111/mpp.13211
`Os03g0576200`	High-affinity potassium transporter.	No verified direct reference in this release
`Os03g0575200`	High-affinity potassium transporter.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037049 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006813 potassium ion transport Biological Process

GO:1901002 positive regulation of response to salt stress Biological Process

GO:1990573 potassium ion import across plasma membrane Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0009674 potassium:sodium symporter activity Molecular Function

GO:0015079 potassium ion transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT4G13420

dosa:Os01g0930400

dosa:Os02g0518600

dosa:Os02g0519100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.643

Rank 1 · TkA08G017260 · TK1151

Cytoplasm0.401

Rank 2 · TkA08G017260 · TK1151

Mitochondrion0.050

Rank 3 · TkA08G017260 · TK1151

Cell membrane0.035

Rank 4 · TkA08G017260 · TK1151

Endoplasmic reticulum0.026

Rank 5 · TkA08G017260 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22776K_trans_C28-103 aa

PF30412YhaZ_C61-93 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G017260	`PF22776`	K_trans_C	28	103	2e-08	34.9
TkA08G017260	`PF30412`	YhaZ_C	61	93	0.023	15.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M7K4`	Arabidopsis thaliana	sp\|Q9M7K4\|POT5_ARATH Potassium transporter 5	45.800%	Swiss-Prot	Medium
`Q5JK32`	Oryza sativa subsp. japonica	sp\|Q5JK32\|HAK5_ORYSJ Potassium transporter 5	42.300%	Swiss-Prot	Medium
`Q75G84`	Oryza sativa subsp. japonica	sp\|Q75G84\|HAK21_ORYSJ Potassium transporter 21	40.900%	Swiss-Prot	Medium
`Q84MS3`	Oryza sativa subsp. japonica	sp\|Q84MS3\|HAK16_ORYSJ Probable potassium transporter 16	41.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card