LXL04_037049 | RubberDandelionOmics

Gene overview

LXL04_037049

Reference: OH-1004 Chr: Chr08 Coordinates: 52315749-52322248 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2382 bp · LXL04_037049|LXL04_037049|OH1004|cDNA

ATGTCAACGCCTGGTGGCAGCCGCAGAAACTCCAACATGAATACTCCTGGCAACAGCAAAAGGAGTTCAAACATAGTCAACATCGATGGTGAAGAACACAACTACCAAAACCATCCTCACCAAACTCCCGATCCACTACTTTTAGATAACGACCTCCCTCCATTGAAGCGCCATGATTCCTTAGACATGGAGTCCGCTAAAATTCAAGGCCACCATGGTCACCATGGCACCAAGGATTGGGGAGTGATACTTAGACTCGC...

CDS

Download CDS FASTA

2382 bp · LXL04_037049|LXL04_037049|OH1004|CDS

ATGTCAACGCCTGGTGGCAGCCGCAGAAACTCCAACATGAATACTCCTGGCAACAGCAAAAGGAGTTCAAACATAGTCAACATCGATGGTGAAGAACACAACTACCAAAACCATCCTCACCAAACTCCCGATCCACTACTTTTAGATAACGACCTCCCTCCATTGAAGCGCCATGATTCCTTAGACATGGAGTCCGCTAAAATTCAAGGCCACCATGGTCACCATGGCACCAAGGATTGGGGAGTGATACTTAGACTCGC...

Protein

Download Protein FASTA

793 aa · LXL04_037049|LXL04_037049|OH1004|PROTEIN

MSTPGGSRRNSNMNTPGNSKRSSNIVNIDGEEHNYQNHPHQTPDPLLLDNDLPPLKRHDSLDMESAKIQGHHGHHGTKDWGVILRLAFQSIGVVYGDIGTSPLYVFASTFTDGIKHEDDILGVLSLIFYTFTIIPVIKYVMIVLHANDNGDGGTFALYSKLCRNAKVGLIPSAQAEDREISNFELELPDNANKISSRVKKYLENSAFAKSFLLFGAMLGTSMVIGDGILTPSISVLSAVSGLKEATDAMTEGRIVVISVI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037049`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037049

Location Chr08:52315749-52322248 (-)

Description Similar to POT5: Potassium transporter 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g13420`	High-affinity potassium transporter.	High-affinity K(+) transport in Arabidopsis: AtHAK5 and AKT1 are vital for seedling establishment and postgermination growth under low-potassium conditions.2010 · DOI: 10.1104/pp.110.154369 The CBL-Interacting Protein Kinase CIPK23 Regulates HAK5-Mediated High-Affinity K+ Uptake in Arabidopsis Roots.2015 · DOI: 10.1104/pp.15.01401

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0930400`	High-affinity potassium transporter.	Rice sodium-insensitive potassium transporter, OsHAK5, confers increased salt tolerance in tobacco BY2 cells.2011 · DOI: 10.1016/j.jbiosc.2010.10.014 The role of a potassium transporter OsHAK5 in potassium acquisition and transport from roots to shoots in rice at low potassium supply levels.2014 · DOI: 10.1104/pp.114.246520 Overexpression of OsHAK5 potassium transporter enhances virus resistance in rice (Oryza sativa).2022 · DOI: 10.1111/mpp.13211
`Os02g0519100`	High-affinity potassium transporter.	No verified direct reference in this release
`Os02g0518600`	High-affinity potassium transporter.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037049 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006813 potassium ion transport Biological Process

GO:1901002 positive regulation of response to salt stress Biological Process

GO:1990573 potassium ion import across plasma membrane Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0009674 potassium:sodium symporter activity Molecular Function

GO:0015079 potassium ion transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT4G13420

dosa:Os01g0930400

dosa:Os02g0518600

dosa:Os02g0519100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.376

Rank 1 · LXL04_037049 · OH-1004

Lysosome / Vacuole0.330

Rank 2 · LXL04_037049 · OH-1004

Cytoplasm0.170

Rank 3 · LXL04_037049 · OH-1004

Endoplasmic reticulum0.137

Rank 4 · LXL04_037049 · OH-1004

Golgi apparatus0.116

Rank 5 · LXL04_037049 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02705.23K_trans85-555 aa

PF22776.1K_trans_C587-761 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037049	`PF02705.23`	K_trans	85	555	4.7e-163	543.6
LXL04_037049	`PF22776.1`	K_trans_C	587	761	1.1e-28	100.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M7K4`	Arabidopsis thaliana	Potassium transporter 5	51.338%	Swiss-Prot	strong database homology
`Q5JK32`	Oryza sativa subsp. japonica	Potassium transporter 5	52.695%	Swiss-Prot	strong database homology
`Q6H4L9`	Oryza sativa subsp. japonica	Potassium transporter 20	50.414%	Swiss-Prot	strong database homology
`Q6H4M2`	Oryza sativa subsp. japonica	Potassium transporter 19	50.694%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card