TkA07G427120 | RubberDandelionOmics

Gene overview

TkA07G427120

Reference: TK1151 Chr: Chr07 Coordinates: 108023386-108025249 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1323 bp · TkA07G427120|TK1151|cDNA

AGTGATAACAACAGCAAGCAGCTTCTTCTTTAAACACACTCTCATGGGTCGCCATTCTTGCTGTATCAAGCAAAAGCTTCGAAAAGGATTATGGTCTCCCGAAGAAGATGAAAAACTTCTCAAATATATTACGAGATTCGGCGTTGGATGCTGGAGTTCGGTTCCTAAACATGCCGGATTGCAAAGATGTGGGAAGAGTTGTAGACTTCGATGGATAAATTACTTGAGGCCCGATCTTAAAAGAGGAATGTTTTCTCAAC...

CDS

Download CDS FASTA

1014 bp · TkA07G427120|TK1151|CDS

ATGGGTCGCCATTCTTGCTGTATCAAGCAAAAGCTTCGAAAAGGATTATGGTCTCCCGAAGAAGATGAAAAACTTCTCAAATATATTACGAGATTCGGCGTTGGATGCTGGAGTTCGGTTCCTAAACATGCCGGATTGCAAAGATGTGGGAAGAGTTGTAGACTTCGATGGATAAATTACTTGAGGCCCGATCTTAAAAGAGGAATGTTTTCTCAACAAGAAGAAGAACTTATACTCAATCTTCATCAACTTCTTGGCAA...

Protein

Download Protein FASTA

337 aa · TkA07G427120|TK1151|PROTEIN

MGRHSCCIKQKLRKGLWSPEEDEKLLKYITRFGVGCWSSVPKHAGLQRCGKSCRLRWINYLRPDLKRGMFSQQEEELILNLHQLLGNRWAQIAAQLPGRTDNEIKNFWNSCLKKKLIKQGIDPNTHKPITDTDDVKDKKIELYDKKSDFYPNSSSSMPMGPELDQAFHINNGGLMLSSSSSMETSSIRDGFSLCDPLFLVEFQSGIDPISYNSNLLAQFHQTNYETSLPNLASFDHRTTTTAAAATATATTTADFSDHSG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G427120`
TK1151 ID	TkA07G427120
OH-1004 ID	LXL04_038989
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	80.600
Protein coverage (%)	TK1151 39.763 / OH-1004 30.180 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G427120

Location Chr07:108023386-108025249 (+)

Description Similar to MYB61: Transcription factor MYB61

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g26660`	Probable transcription factor.	No verified direct reference in this release
`At1g09540`	Transcription factor that coordinates a small network of downstream target genes required for several aspects of plant growth and development, such as xylem formation and xylem cell differentiation, and lateral root formation.	AtMYB61, an R2R3-MYB transcription factor controlling stomatal aperture in Arabidopsis thaliana.2005 · DOI: 10.1016/j.cub.2005.06.041 MUM ENHANCERS are important for seed coat mucilage production and mucilage secretory cell differentiation in Arabidopsis thaliana.2009 · DOI: 10.1093/jxb/erp102 AtMYB61, an R2R3-MYB transcription factor, functions as a pleiotropic regulator via a small gene network.2012 · DOI: 10.1111/j.1469-8137.2012.04201.x Interactions between the R2R3-MYB transcription factor, AtMYB61, and target DNA binding sites.2013 · DOI: 10.1371/journal.pone.0065132 AaMYB1 and its orthologue AtMYB61 affect terpene metabolism and trichome development in Artemisia annua and Arabidopsis thaliana.2017 · DOI: 10.1111/tpj.13509
`At4g34990`	Transcription factor MYB32.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038989 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009908 flower development Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0010089 xylem development Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0010214 seed coat development Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0048364 root development Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

KEGG gene cross-reference

ath:AT1G09540

ath:AT3G61250

ath:AT5G26660

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.958

Rank 1 · TkA07G427120 · TK1151

Cytoplasm0.132

Rank 2 · TkA07G427120 · TK1151

Cell membrane0.022

Rank 3 · TkA07G427120 · TK1151

Endoplasmic reticulum0.012

Rank 4 · TkA07G427120 · TK1151

Mitochondrion0.010

Rank 5 · TkA07G427120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249Myb_DNA-binding14-61 aa

PF13921Myb_DNA-bind_617-76 aa

PF23588HTH_CHD1_Hrp317-41 aa

PF00249Myb_DNA-binding67-112 aa

PF13921Myb_DNA-bind_670-118 aa

PF21827New_glue237-273 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G427120	`PF00249`	Myb_DNA-binding	14	61	2.2e-36	124.4
TkA07G427120	`PF13921`	Myb_DNA-bind_6	17	76	4.3e-21	75.6
TkA07G427120	`PF23588`	HTH_CHD1_Hrp3	17	41	0.0025	18.5
TkA07G427120	`PF00249`	Myb_DNA-binding	67	112	2.2e-36	124.4
TkA07G427120	`PF13921`	Myb_DNA-bind_6	70	118	4.3e-21	75.6
TkA07G427120	`PF21827`	New_glue	237	273	5.3	7.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LPH6`	Arabidopsis thaliana	sp\|Q8LPH6\|MYB86_ARATH Transcription factor MYB86	84.500%	Swiss-Prot	Low
`Q8VZQ2`	Arabidopsis thaliana	sp\|Q8VZQ2\|MYB61_ARATH Transcription factor MYB61	77.500%	Swiss-Prot	Low
`O49608`	Arabidopsis thaliana	sp\|O49608\|MYB32_ARATH Transcription factor MYB32	64.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card