LXL04_038989 | RubberDandelionOmics

Gene overview

LXL04_038989

Reference: OH-1004 Chr: Chr09 Coordinates: 55729042-55730547 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1359 bp · LXL04_038989|LXL04_038989|OH1004|cDNA

GAGGGGATCCCTCCCCCTATTAATTTGAACCCCCACTCTTCCAGCCTGCCCCTCCAGTTTGAATACCTGCTACAAGTCTTCATCccgttctctctctctctctctctctctctctctctcgttgtctttctttttctctctccAAAGCTAGCTTTCAACCCCTCCTTTTTGGGTGACAGTTCGCACAAAAGTATTCTTAAATACAAAACCCTTTATTCATCTTTGTGTCTCAAGCTTATTTGTAGAATCTGCCTCGTCCA...

CDS

Download CDS FASTA

1335 bp · LXL04_038989|LXL04_038989|OH1004|CDS

TTGAACCCCCACTCTTCCAGCCTGCCCCTCCAGTTTGAATACCTGCTACAAGTCTTCATCCCGTTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCGTTGTCTTTCTTTTTCTCTCTCCAAAGCTAGCTTTCAACCCCTCCTTTTTGGGTGACAGTTCGCACAAAAGTATTCTTAAATACAAAACCCTTTATTCATCTTTGTGTCTCAAGCTTATTTGTAGAATCTGCCTCGTCCACATGGGGAGGCACTCTTGTTGTTA...

Protein

Download Protein FASTA

444 aa · LXL04_038989|LXL04_038989|OH1004|PROTEIN

MNPHSSSLPLQFEYLLQVFIPFSLSLSLSLSLVVFLFLSPKLAFNPSFLGDSSHKSILKYKTLYSSLCLKLICRICLVHMGRHSCCYKQKLRKGLWSPEEDEKLIKHITKFGHGCWSSVPKLAGLERCGKSCRLRWINYLRPDLKRGTFSQQEEKLIIELHAVLGNKWSQIAAQLPGRTDNEIKNLWNSSIKKKLRQRGIDPNTHKPLSEVNDDRKDPSGSNEKNSQGSYLEEKTEPLTAAMGSSYPVVDNPPPATHEFF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038989`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038989

Location Chr09:55729042-55730547 (+)

Description Similar to MYB61: Transcription factor MYB61

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g09540`	Transcription factor that coordinates a small network of downstream target genes required for several aspects of plant growth and development, such as xylem formation and xylem cell differentiation, and lateral root formation.	AtMYB61, an R2R3-MYB transcription factor controlling stomatal aperture in Arabidopsis thaliana.2005 · DOI: 10.1016/j.cub.2005.06.041 MUM ENHANCERS are important for seed coat mucilage production and mucilage secretory cell differentiation in Arabidopsis thaliana.2009 · DOI: 10.1093/jxb/erp102 AtMYB61, an R2R3-MYB transcription factor, functions as a pleiotropic regulator via a small gene network.2012 · DOI: 10.1111/j.1469-8137.2012.04201.x Interactions between the R2R3-MYB transcription factor, AtMYB61, and target DNA binding sites.2013 · DOI: 10.1371/journal.pone.0065132 AaMYB1 and its orthologue AtMYB61 affect terpene metabolism and trichome development in Artemisia annua and Arabidopsis thaliana.2017 · DOI: 10.1111/tpj.13509
`At5g26660`	Probable transcription factor.	No verified direct reference in this release
`At3g61250`	Transcription factor that may play a role in flower development by repressing ANT.	Characterization of Arabidopsis MYB transcription factor gene AtMYB17 and its possible regulation by LEAFY and AGL15.2009 · DOI: 10.1016/s1673-8527(08)60096-x LATE MERISTEM IDENTITY2 acts together with LEAFY to activate APETALA1.2011 · DOI: 10.1242/dev.063073

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038989 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009908 flower development Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0010089 xylem development Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0010214 seed coat development Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0048364 root development Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

KEGG gene cross-reference

ath:AT1G09540

ath:AT3G61250

ath:AT5G26660

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.838

Rank 1 · LXL04_038989 · OH-1004

Cytoplasm0.250

Rank 2 · LXL04_038989 · OH-1004

Mitochondrion0.026

Rank 3 · LXL04_038989 · OH-1004

Cell membrane0.025

Rank 4 · LXL04_038989 · OH-1004

Endoplasmic reticulum0.019

Rank 5 · LXL04_038989 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249.38Myb_DNA-binding93-140 aa

PF13921.13Myb_DNA-bind_696-155 aa

PF00249.38Myb_DNA-binding146-189 aa

PF13921.13Myb_DNA-bind_6149-198 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038989	`PF00249.38`	Myb_DNA-binding	93	140	4.2e-33	113.9
LXL04_038989	`PF13921.13`	Myb_DNA-bind_6	96	155	9e-21	74.5
LXL04_038989	`PF00249.38`	Myb_DNA-binding	146	189	4.2e-33	113.9
LXL04_038989	`PF13921.13`	Myb_DNA-bind_6	149	198	9e-21	74.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VZQ2`	Arabidopsis thaliana	Transcription factor MYB61	43.928%	Swiss-Prot	moderate database homology
`Q8LPH6`	Arabidopsis thaliana	Transcription factor MYB86	84.496%	Swiss-Prot	weak database homology
`Q9M2D9`	Arabidopsis thaliana	Transcription factor MYB17	65.000%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card