TkA07G422630 | RubberDandelionOmics

Gene overview

TkA07G422630

Reference: TK1151 Chr: Chr07 Coordinates: 106831243-106833190 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1260 bp · TkA07G422630|TK1151|cDNA

TTTTTAATCCCTACTAAAATCAATAATTTAAGCTTGCAATTAGTTTAATAACTAATGTTTAACCAAATTACCCACCCAATATGAACCTATTTGAAGTCTCTTTCATCAAAATAGATCATGGTGAGACCTCCTTGTTGTGATAAGCTAACTATGCGAAAAGGGCCATGGAACGAAGAAGATGATGCACAAATGCTCGCGTTTGTAACCAAACAACCAACACCAAATTGGCAAGCAGCGGCTCCCAAGAAACCAGGTTTAAG...

CDS

Download CDS FASTA

981 bp · TkA07G422630|TK1151|CDS

ATGGTGAGACCTCCTTGTTGTGATAAGCTAACTATGCGAAAAGGGCCATGGAACGAAGAAGATGATGCACAAATGCTCGCGTTTGTAACCAAACAACCAACACCAAATTGGCAAGCAGCGGCTCCCAAGAAACCAGGTTTAAGAAGATGCGGAAAGACTTGTAGGTTAAGGAAAACAAATGTTGCAACAAATGATCATATTCGGCATCAAACCTTTACACAACAAGAAGAGGAGTTAATCATCAAGCTTCATTCCGCTAT...

Protein

Download Protein FASTA

326 aa · TkA07G422630|TK1151|PROTEIN

MVRPPCCDKLTMRKGPWNEEDDAQMLAFVTKQPTPNWQAAAPKKPGLRRCGKTCRLRKTNVATNDHIRHQTFTQQEEELIIKLHSAIGSRWPIIAQQLPGRTDNDVKNYWNTKLKKKLSAMGIDPVTHRPFSQMLADYGTISGLTRNQTRMGSLNQSNNNTFFISNQENVFQNPPSESIFPNFNNSIKMEPPESIKSDSLDLLTQLQAITHVKESSTNHGIGIFHVSVASSSSSSSSSCSTLNEMMPQQTFNWRDFLIEN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G422630`
TK1151 ID	TkA07G422630
OH-1004 ID	LXL04_030673
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G422630

Location Chr07:106831243-106833190 (+)

Description Similar to MYB35: Transcription factor MYB35

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g28470`	Required for anther development and early tapetal function during microspore maturation.	Defective in Tapetal development and function 1 is essential for anther development and tapetal function for microspore maturation in Arabidopsis.2008 · DOI: 10.1111/j.1365-313x.2008.03500.x A genetic pathway for tapetum development and function in Arabidopsis.2011 · DOI: 10.1111/j.1744-7909.2011.01078.x
`At5g56110`	Transcription factor that binds to the DNA sequence 5'- CCAACC-3'.	AtMYB103 regulates tapetum and trichome development in Arabidopsis thaliana.2003 · DOI: 10.1046/j.1365-313x.2003.01791.x Transcription factor AtMYB103 is required for anther development by regulating tapetum development, callose dissolution and exine formation in Arabidopsis.2007 · DOI: 10.1111/j.1365-313x.2007.03254.x The MYB80 transcription factor is required for pollen development and the regulation of tapetal programmed cell death in Arabidopsis thaliana.2011 · DOI: 10.1105/tpc.110.082651
`At5g15310`	Involved in the control of epidermal cell morphogenesis in petals.	Control of cell and petal morphogenesis by R2R3 MYB transcription factors.2007 · DOI: 10.1242/dev.02836 MIXTA-like transcription factors and WAX INDUCER1/SHINE1 coordinately regulate cuticle development in Arabidopsis and Torenia fournieri.2013 · DOI: 10.1105/tpc.113.110783 The MIXTA-like transcription factor MYB16 is a major regulator of cuticle formation in vegetative organs.2013 · DOI: 10.4161/psb.26826
`At3g01140`	Functions as a repressor of epidermal cell outgrowth and negatively regulate trichome branch formation.	Transcriptional profiling of mature Arabidopsis trichomes reveals that NOECK encodes the MIXTA-like transcriptional regulator MYB106.2008 · DOI: 10.1104/pp.108.126979 MIXTA-like transcription factors and WAX INDUCER1/SHINE1 coordinately regulate cuticle development in Arabidopsis and Torenia fournieri.2013 · DOI: 10.1105/tpc.113.110783 The MIXTA-like transcription factor MYB16 is a major regulator of cuticle formation in vegetative organs.2013 · DOI: 10.4161/psb.26826

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0470600`	Essential for tapetum development in anthers and microsporogenesis.	MYB80, a regulator of tapetal and pollen development, is functionally conserved in crops.2012 · DOI: 10.1007/s11103-011-9855-0

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030673 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000902 cell morphogenesis Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009555 pollen development Biological Process

GO:0010090 trichome morphogenesis Biological Process

GO:0010091 trichome branching Biological Process

GO:0048658 anther wall tapetum development Biological Process

GO:0052545 callose localization Biological Process

GO:0055046 microgametogenesis Biological Process

GO:1901957 regulation of cutin biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT3G01140

ath:AT3G28470

ath:AT5G15310

ath:AT5G56110

osa:9272494

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.946

Rank 1 · TkA07G422630 · TK1151

Cytoplasm0.170

Rank 2 · TkA07G422630 · TK1151

Cell membrane0.018

Rank 3 · TkA07G422630 · TK1151

Mitochondrion0.016

Rank 4 · TkA07G422630 · TK1151

Endoplasmic reticulum0.010

Rank 5 · TkA07G422630 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249Myb_DNA-binding14-57 aa

PF13921Myb_DNA-bind_617-77 aa

PF00249Myb_DNA-binding70-112 aa

PF13921Myb_DNA-bind_672-119 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G422630	`PF00249`	Myb_DNA-binding	14	57	4e-20	72.4
TkA07G422630	`PF13921`	Myb_DNA-bind_6	17	77	2.7e-11	44.2
TkA07G422630	`PF00249`	Myb_DNA-binding	70	112	4e-20	72.4
TkA07G422630	`PF13921`	Myb_DNA-bind_6	72	119	2.7e-11	44.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LSI7`	Arabidopsis thaliana	sp\|Q9LSI7\|MYB35_ARATH Transcription factor MYB35	62.900%	Swiss-Prot	Low
`Q9XHV0`	Arabidopsis thaliana	sp\|Q9XHV0\|MYB80_ARATH Transcription factor MYB80	55.000%	Swiss-Prot	Low
`Q9LXF1`	Arabidopsis thaliana	sp\|Q9LXF1\|MYB16_ARATH Transcription factor MYB16	54.600%	Swiss-Prot	Low
`Q9LE63`	Arabidopsis thaliana	sp\|Q9LE63\|MY106_ARATH Transcription factor MYB106	47.400%	Swiss-Prot	Low
`Q7XQN1`	Oryza sativa subsp. japonica	sp\|Q7XQN1\|MYB80_ORYSJ Transcription factor MYB80	57.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card