TkA07G414330 | RubberDandelionOmics

Gene overview

TkA07G414330

Reference: TK1151 Chr: Chr07 Coordinates: 104705891-104715362 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

733 bp · TkA07G414330|TK1151|cDNA

TCAATTATCATTGAATTTTTTAAATTATTAATGTATATTTACTCACGTATGTTTTCACAACTTCAGCTCCTACTCTTAACTTTCATTGATTCAACTAACAGCCATCTTCACAACATTCATTATGGTGCGTTTACAGCTTGATCCATTTCTCAGTGAACTAACTAACATGTTTGAGCACACTACAGAAAAAGGATCTGTGTGGGTTACTCTCAAACACTCTTCTGACAAGTCTAAGGTACAGAGAGATAAGATGGAAAGTT...

CDS

Download CDS FASTA

2472 bp · TkA07G414330|TK1151|CDS

ATGCTGTCCAATTTGAAGAAAAGCATATTAAACCAAAAATGGGCTGTTTTGATTGTTGATGAATCACATCATGTACGTTGTACAAAACGTGTAGCATCAGAAGCAGGAGAGACACAGGCCTTACTTGATATTTCATCAACGATCAACCGTATTGTTTTACTCTCAGGGACTCCTTCTTTGTCAAGACCGTTTGACATATATCATCAAATAAATATTTTATGGCCTGGGTTACTTGGAAAGGACAAGATTGCATTTGCAAA...

Protein

Download Protein FASTA

823 aa · TkA07G414330|TK1151|PROTEIN

MLSNLKKSILNQKWAVLIVDESHHVRCTKRVASEAGETQALLDISSTINRIVLLSGTPSLSRPFDIYHQINILWPGLLGKDKIAFAKTYCSMSTTQTSQGIVYQDFSKGVRLDELNVLLKQTVMIRRLKEHVLMQLPPLRRQIINLELKKSDIESAKAICSTPNDDAFPVNIAEDGENDSTNDKSSRLSNQVIGIAKLPGFLEWLRMHPIISEADDDDENPGQSQQSQKSQSSHKMIIFVHHHKVTDRLQEFLCDKGIRF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G414330`
TK1151 ID	TkA07G414330
OH-1004 ID	LXL04_030603
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 75.989 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G414330

Location Chr07:104705891-104715362 (-)

Description Similar to ZRANB3: DNA annealing helicase and endonuclease ZRANB3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g43640`	Component of the signal recognition particle (SRP) complex, a ribonucleoprotein complex that mediates the cotranslational targeting of secretory and membrane proteins to the endoplasmic reticulum (ER) (By similarity).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0623700`	Component of the signal recognition particle (SRP) complex, a ribonucleoprotein complex that mediates the cotranslational targeting of secretory and membrane proteins to the endoplasmic reticulum (ER) (By similarity).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030603 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0006974 DNA damage response Biological Process

GO:0009411 response to UV Biological Process

GO:0031297 replication fork processing Biological Process

GO:0071932 replication fork reversal Biological Process

GO:0005654 nucleoplasm Cellular Component

GO:0043596 nuclear replication fork Cellular Component

GO:0004386 helicase activity Molecular Function

GO:0004520 DNA endonuclease activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

KEGG gene cross-reference

hsa:84083

mmu:226409

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.696

Rank 1 · TkA07G414330 · TK1151

Cytoplasm0.281

Rank 2 · TkA07G414330 · TK1151

Mitochondrion0.066

Rank 3 · TkA07G414330 · TK1151

Cell membrane0.040

Rank 4 · TkA07G414330 · TK1151

Endoplasmic reticulum0.022

Rank 5 · TkA07G414330 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00176SNF2-rel_dom4-158 aa

PF13401AAA_224-61 aa

PF04177TAP42189-289 aa

PF00271Helicase_C230-331 aa

PF13307Helicase_C_2232-324 aa

PF13401AAA_22247-292 aa

PF13401AAA_22337-365 aa

PF00176SNF2-rel_dom598-635 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G414330	`PF00176`	SNF2-rel_dom	4	158	9.9e-12	45.3
TkA07G414330	`PF13401`	AAA_22	4	61	0.15	13.1
TkA07G414330	`PF04177`	TAP42	189	289	0.0016	18.4
TkA07G414330	`PF00271`	Helicase_C	230	331	3.5e-16	60.1
TkA07G414330	`PF13307`	Helicase_C_2	232	324	0.073	13.8
TkA07G414330	`PF13401`	AAA_22	247	292	0.15	13.1
TkA07G414330	`PF13401`	AAA_22	337	365	0.15	13.1
TkA07G414330	`PF00176`	SNF2-rel_dom	598	635	9.9e-12	45.3
TkA07G414330	`PF11809`	DUF3330	626	663	0.11	13.3
TkA07G414330	`PF01844`	HNH	675	681	4.6e-05	24.2
TkA07G414330	`PF01844`	HNH	727	758	4.6e-05	24.2
TkA07G414330	`PF04177`	TAP42	763	801	0.0016	18.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O04421`	Arabidopsis thaliana	sp\|O04421\|SRP14_ARATH Signal recognition particle 14 kDa protein	69.300%	Swiss-Prot	High
`O04433`	Oryza sativa subsp. japonica	sp\|O04433\|SRP14_ORYSJ Signal recognition particle 14 kDa protein	62.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card