Gene Card
Gene overview
cDNA / CDS / Protein Sequences
3264 bp · LXL04_030603|LXL04_030603|OH1004|cDNA
ATGGAAGTACAGACTCTTGCCGTCGAAGCAAAGCGCAAGGCGGACGACGTCGATGATGCACCCTGGAAAATTGCCAAGTGTCAAAAGCTCTCTTCAGAAAAATTCATCGCCCAACTCGAGATTTCTTCCCCGGATTCGTTCTCAGTAAAGCCGTTGGGTGTTAATGGTTACACGTTCCCCGGTGACGCTGCTTGCTTTGCAAAATTAAGCGAGTGCCTCTCTAATGTGGTGCCGACACATTACACACAAAACCATGGCGG...
3264 bp · LXL04_030603|LXL04_030603|OH1004|CDS
ATGGAAGTACAGACTCTTGCCGTCGAAGCAAAGCGCAAGGCGGACGACGTCGATGATGCACCCTGGAAAATTGCCAAGTGTCAAAAGCTCTCTTCAGAAAAATTCATCGCCCAACTCGAGATTTCTTCCCCGGATTCGTTCTCAGTAAAGCCGTTGGGTGTTAATGGTTACACGTTCCCCGGTGACGCTGCTTGCTTTGCAAAATTAAGCGAGTGCCTCTCTAATGTGGTGCCGACACATTACACACAAAACCATGGCGG...
Protein
Download Protein FASTA1087 aa · LXL04_030603|LXL04_030603|OH1004|PROTEIN
MEVQTLAVEAKRKADDVDDAPWKIAKCQKLSSEKFIAQLEISSPDSFSVKPLGVNGYTFPGDAACFAKLSECLSNVVPTHYTQNHGGGEACVFKLTDYDAVVRSLKSQRIEYQDIPYITRRAVTLLSRPYIEGRWEPCSREHLTDEQVDEKMKQLPKSLLDVLLPFQFEGVKFGLRRGGRCLIADEMGLGKTLQAIAIASCFMNEGPVLVVCPAILRYTWAEELEHWLPSCLPSDIHLVFGHENNPANLARTPKVVVISY...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_030603 |
|---|---|
| TK1151 ID | TkA07G414330 |
| OH-1004 ID | LXL04_030603 |
| Relationship / confidence | Rbh Sequence Supported / Probable |
| Protein identity (%) | 99.600 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 75.989Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_030603 |
|---|---|
| Location | Chr06:119443677-119450081 (-) |
| Description | Similar to ZRANB3: DNA annealing helicase and endonuclease ZRANB3 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006281 DNA repair Biological Process GO:0006974 DNA damage response Biological Process GO:0009411 response to UV Biological Process GO:0031297 replication fork processing Biological Process GO:0071932 replication fork reversal Biological Process GO:0005654 nucleoplasm Cellular Component GO:0043596 nuclear replication fork Cellular Component GO:0004386 helicase activity Molecular Function GO:0004520 DNA endonuclease activity Molecular Function GO:0005524 ATP binding Molecular Function GO:0008270 zinc ion binding Molecular Function GO:0016887 ATP hydrolysis activity Molecular Function |
| KEGG gene cross-reference | hsa:84083 mmu:226409 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00176.30SNF2-rel_dom167-419 aaPF04851.22ResIII178-310 aaPF00271.38Helicase_C491-595 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_030603 | PF00176.30 | SNF2-rel_dom | 167 | 419 | 7.7e-33 | 114.5 |
| LXL04_030603 | PF04851.22 | ResIII | 178 | 310 | 1.9e-09 | 38.3 |
| LXL04_030603 | PF00271.38 | Helicase_C | 491 | 595 | 6.4e-15 | 56.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.