TkA07G400380 | RubberDandelionOmics

Gene overview

TkA07G400380

Reference: TK1151 Chr: Chr07 Coordinates: 100620440-100625290 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1495 bp · TkA07G400380|TK1151|cDNA

AAGAAAAGAAAATTAATTCCGTTGATCTGTTTCATTTCTCTTTTCAAAGCACGCTAAATTCATTTCTTACTTCTTCTGTAAACTGTTTAGAAGTGCTGCCCGCAATCGGAACCGGGTCAACCCGCAGATATATGAAGTCGGTCGTACGAATTACCAACCACACGAATCCCGTATATTAGGTTGCTGCATACTCGATGACGAAGCTTTTCCAATTTCTCCATGCTTCATTTCTTCATCGACTTTAAGATCGTCATTGATCA...

CDS

Download CDS FASTA

1377 bp · TkA07G400380|TK1151|CDS

ATGATTAGGGTTACGGTTTCTGATAGCCTATGTCCTCTGTCTTCCTCAGATCTCGAGCTGTCTTCCCAAGATCTCGAGCTCCCTCTCCAATTCTCAGCTGTTTTACGGTTCACAAACGTGTTTCCGGCGACAATCGAGCAGTCTTCCTCAGATCTCGAGCTGTCTTCCTCAGATCTCGAGTTGTCTTCCTCAGATCTCGAAATGTCTCTCCGATTCTCGGCGATAAGTGCTGCCCGCAATCGGAACCGGGTCAACCCGCA...

Protein

Download Protein FASTA

458 aa · TkA07G400380|TK1151|PROTEIN

MIRVTVSDSLCPLSSSDLELSSQDLELPLQFSAVLRFTNVFPATIEQSSSDLELSSSDLELSSSDLEMSLRFSAISAARNRNRVNPQIYEVGRTNYQPHESRILGCCILDDEAFPISPCFISSSTLRSSLIMASDYAKNIVAELESASQLRAAGFFITRRPWLDLYGVNVRPVAPFGSTCSKPVVDLSLIHRCLPDELLFEIFARMTPYNLGKAACVCRKWRNTVRNPVFWRNACLKAWQISGVVENYKLMQCIYDSSWR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G400380`
TK1151 ID	TkA07G400380
OH-1004 ID	LXL04_030377
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	93.600
Protein coverage (%)	TK1151 96.070 / OH-1004 89.941 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G400380

Location Chr07:100620440-100625290 (-)

Description Similar to SKIP32: F-box protein 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g21760`	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity).	The evolutionarily conserved Arabidopsis thaliana F-box protein AtFBP7 is required for efficient translation during temperature stress.2007 · DOI: 10.1016/j.gene.2006.11.016

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030377 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006417 regulation of translation Biological Process

GO:0009408 response to heat Biological Process

GO:0009409 response to cold Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process Biological Process

GO:0032006 regulation of TOR signaling Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0045087 innate immune response Biological Process

GO:0070936 protein K48-linked ubiquitination Biological Process

GO:0000151 ubiquitin ligase complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G21760

bta:511798

hsa:26268

mmu:71538

rno:300849

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.428

Rank 1 · TkA07G400380 · TK1151

Nucleus0.425

Rank 2 · TkA07G400380 · TK1151

Cell membrane0.099

Rank 3 · TkA07G400380 · TK1151

Mitochondrion0.090

Rank 4 · TkA07G400380 · TK1151

Endoplasmic reticulum0.073

Rank 5 · TkA07G400380 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box193-232 aa

PF12937F-box-like193-236 aa

PF19270FBO_C248-458 aa

PF12937F-box-like254-262 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G400380	`PF00646`	F-box	193	232	1.8e-12	47.3
TkA07G400380	`PF12937`	F-box-like	193	236	4.5e-12	46.3
TkA07G400380	`PF19270`	FBO_C	248	458	3.8e-101	337.7
TkA07G400380	`PF12937`	F-box-like	254	262	4.5e-12	46.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9XI00`	Arabidopsis thaliana	sp\|Q9XI00\|SKI32_ARATH F-box protein 7	72.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card