TkA07G399790 | RubberDandelionOmics

Gene overview

TkA07G399790

Reference: TK1151 Chr: Chr07 Coordinates: 100440047-100453313 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1347 bp · TkA07G399790|TK1151|cDNA

TTGTCTCAGCCAGCTCCCTATGCAACATGATGAGATGAGGGATGGTTTGTAGGGTTTTTAAGACTATAATATATATCTTCCATTGAAGACAGATTAAAAGAGAGAGGTGATCATTTTCTTCTTTCTTCTTCAAAGGTACTGTTTTTGGTCTGTTTATATATACCCATTTACATGTTCATACAGATTCTATATCTTCATCCGTAGATTAATTATATGCATACAGTATGGAGCTCTTTCAGTCTCTTTTCTAGCTAGTAGTT...

CDS

Download CDS FASTA

741 bp · TkA07G399790|TK1151|CDS

ATGGAGGAGCTTACTATTTCTCACCTTCATCAGGTTTTGAGAGAGAAGGAAAAGATGGGGAGAGGAAAGATCGAGATCAAGAGGATTGAGAACAACACAAATCGTCAGGTGACCTTCTGCAAAAGGAGAAATGGGCTTCTCAAGAAAGCTTACGAGCTTTCTGTTCTCTGTGATGCTGAGATCGCCTTGATTGTCTTCTCCACTCGTGGTCGACTCTATGAGTATGCCAATAACAACATGAGATCAACCATAGACAAGTA...

Protein

Download Protein FASTA

246 aa · TkA07G399790|TK1151|PROTEIN

MEELTISHLHQVLREKEKMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSTRGRLYEYANNNMRSTIDKYKKATSNTPNSTCSLQETNAQFYQQESKKLRQQIQMRQNSNRHLMGEGLDCLNMKELKQLETRLERAISRIRSKKHDMILGEMESLQKREVELEHHNTFLRSKIAENERVHQHEVGSVGEEYNAIQAYLARNSLQLNIMDPLEEAPSAYSLLPNKSLHIG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G399790`
TK1151 ID	TkA07G399790
OH-1004 ID	LXL04_030363
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 99.595 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G399790

Location Chr07:100440047-100453313 (+)

Description Similar to AGL11: Agamous-like MADS-box protein AGL11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g09960`	Probable transcription factor (Probable).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030363 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0009908 flower development Biological Process

GO:0010214 seed coat development Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

GO:0048316 seed development Biological Process

GO:0048440 carpel development Biological Process

GO:0048481 plant ovule development Biological Process

GO:0048608 reproductive structure development Biological Process

GO:0051302 regulation of cell division Biological Process

KEGG gene cross-reference

ath:AT4G09960

vvi:100232864

vvi:100232870

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.960

Rank 1 · TkA07G399790 · TK1151

Cytoplasm0.106

Rank 2 · TkA07G399790 · TK1151

Cell membrane0.027

Rank 3 · TkA07G399790 · TK1151

Endoplasmic reticulum0.014

Rank 4 · TkA07G399790 · TK1151

Plastid0.011

Rank 5 · TkA07G399790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21463Cry1Ac_dom-VII11-35 aa

PF06698DUF119224-35 aa

PF00319SRF-TF28-75 aa

PF15206FAM20944-69 aa

PF13475DUF411659-97 aa

PF21294Polysacc_lyase_1469-128 aa

PF01486K-box102-190 aa

PF16521Myosin-VI_CBD102-152 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G399790	`PF21463`	Cry1Ac_dom-VII	11	35	0.12	12.9
TkA07G399790	`PF06698`	DUF1192	24	35	0.39	11.6
TkA07G399790	`PF00319`	SRF-TF	28	75	2.4e-26	91.6
TkA07G399790	`PF15206`	FAM209	44	69	0.035	14.5
TkA07G399790	`PF13475`	DUF4116	59	97	0.03	14.6
TkA07G399790	`PF21294`	Polysacc_lyase_14	69	128	0.059	13.8
TkA07G399790	`PF01486`	K-box	102	190	3.7e-25	88.6
TkA07G399790	`PF16521`	Myosin-VI_CBD	102	152	0.044	14.5
TkA07G399790	`PF06698`	DUF1192	126	160	0.39	11.6
TkA07G399790	`PF15206`	FAM209	140	184	0.035	14.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q38836`	Arabidopsis thaliana	sp\|Q38836\|AGL11_ARATH Agamous-like MADS-box protein AGL11	65.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card