LXL04_030363 | RubberDandelionOmics

Gene overview

LXL04_030363

Reference: OH-1004 Chr: Chr06 Coordinates: 114896735-114903193 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

744 bp · LXL04_030363|LXL04_030363|OH1004|cDNA

ATGGAGGAGCTTACTATTTCTCACCTTCATCAGGTTTTGAGAGAGAAGGAAAAGATGGGGAGAGGAAAGATCGAGATCAAGAGGATTGAGAACAACACAAATCGTCAGGTGACCTTCTGCAAAAGGAGAAATGGGCTTCTCAAGAAAGCTTACGAGCTTTCTGTTCTCTGTGATGCTGAGATCGCCTTGATTGTCTTCTCCACTCGTGGTCGACTCTATGAGTATGCCAATAACAACATGAGATCAACCATAGACAAGTA...

CDS

Download CDS FASTA

744 bp · LXL04_030363|LXL04_030363|OH1004|CDS

ATGGAGGAGCTTACTATTTCTCACCTTCATCAGGTTTTGAGAGAGAAGGAAAAGATGGGGAGAGGAAAGATCGAGATCAAGAGGATTGAGAACAACACAAATCGTCAGGTGACCTTCTGCAAAAGGAGAAATGGGCTTCTCAAGAAAGCTTACGAGCTTTCTGTTCTCTGTGATGCTGAGATCGCCTTGATTGTCTTCTCCACTCGTGGTCGACTCTATGAGTATGCCAATAACAACATGAGATCAACCATAGACAAGTA...

Protein

Download Protein FASTA

247 aa · LXL04_030363|LXL04_030363|OH1004|PROTEIN

MEELTISHLHQVLREKEKMGRGKIEIKRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSTRGRLYEYANNNMRSTIDKYKKATSNTPNSTCSLQETNAQFYQQESKKLRQQIQMRQNSNRHLMGEGLDCLNMKELKQLETRLERAISRIRSKKHDMILGEMESLQKREVELEHHNTFLRSKIAENERVHQHEVGSVGEEYNAIQAYLARNSLQLNIMDPLEEAPSAYSLLPNKSLHIGY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030363`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030363

Location Chr06:114896735-114903193 (+)

Description Similar to AGL11: Agamous-like MADS-box protein AGL11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g09960`	Probable transcription factor (Probable).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030363 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0009908 flower development Biological Process

GO:0010214 seed coat development Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

GO:0048316 seed development Biological Process

GO:0048440 carpel development Biological Process

GO:0048481 plant ovule development Biological Process

GO:0048608 reproductive structure development Biological Process

GO:0051302 regulation of cell division Biological Process

KEGG gene cross-reference

ath:AT4G09960

vvi:100232864

vvi:100232870

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.960

Rank 1 · LXL04_030363 · OH-1004

Cytoplasm0.107

Rank 2 · LXL04_030363 · OH-1004

Cell membrane0.027

Rank 3 · LXL04_030363 · OH-1004

Endoplasmic reticulum0.014

Rank 4 · LXL04_030363 · OH-1004

Plastid0.011

Rank 5 · LXL04_030363 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00319.24SRF-TF28-75 aa

PF01486.23K-box102-190 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030363	`PF00319.24`	SRF-TF	28	75	2.4e-26	91.6
LXL04_030363	`PF01486.23`	K-box	102	190	3.8e-25	88.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q38836`	Arabidopsis thaliana	Agamous-like MADS-box protein AGL11	65.368%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card