Gene Card
Gene overview
cDNA / CDS / Protein Sequences
480 bp · TkA07G399720|TK1151|cDNA
GCAGTGTCGGCGCTTCTATGGAGATGCATAATGCGAGTACGATTCCTACCACGTGATAATGAAACAGTCTGTAGACTTGCAATTAGTAACAGATCTAGACTAAACCCACCATTATCTGACGATTATTTCGGTAATCCGATTCAGTTCGTGAGGGGAATTGCAACTGTCGAGGATCTACTGAATCAGGGGATAGGATGGGCGGCTTTGAAGTTACATGAGGCGGTGGCAAACCACGACGATGGAGCAGTGAAGAAATGGGT...
480 bp · TkA07G399720|TK1151|CDS
GCAGTGTCGGCGCTTCTATGGAGATGCATAATGCGAGTACGATTCCTACCACGTGATAATGAAACAGTCTGTAGACTTGCAATTAGTAACAGATCTAGACTAAACCCACCATTATCTGACGATTATTTCGGTAATCCGATTCAGTTCGTGAGGGGAATTGCAACTGTCGAGGATCTACTGAATCAGGGGATAGGATGGGCGGCTTTGAAGTTACATGAGGCGGTGGCAAACCACGACGATGGAGCAGTGAAGAAATGGGT...
Protein
Download Protein FASTA159 aa · TkA07G399720|TK1151|PROTEIN
AVSALLWRCIMRVRFLPRDNETVCRLAISNRSRLNPPLSDDYFGNPIQFVRGIATVEDLLNQGIGWAALKLHEAVANHDDGAVKKWVEDWFRSPQVYGCEFGLGKAVAAISGCANKADGKMTLYPGREGGGSMDVEVCLLPEYMEGFECDEELVSALKE
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G399720 |
|---|---|
| TK1151 ID | TkA07G399720 |
| OH-1004 ID | LXL04_030358 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 57.800 |
| Protein coverage (%) | TK1151 98.742 / OH-1004 39.560Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G399720 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr07:100406199-100406744 (-) | |||||||||
| Description | Similar to At3g50280: Uncharacterized acetyltransferase At3g50280 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006952 defense response Biological Process GO:0009617 response to bacterium Biological Process GO:0009697 salicylic acid biosynthetic process Biological Process GO:0009753 response to jasmonic acid Biological Process GO:0009809 lignin biosynthetic process Biological Process GO:0009813 flavonoid biosynthetic process Biological Process GO:0009963 positive regulation of flavonoid biosynthetic process Biological Process GO:0010090 trichome morphogenesis Biological Process GO:0010143 cutin biosynthetic process Biological Process GO:0071555 cell wall organization Biological Process GO:0090626 plant epidermis morphogenesis Biological Process GO:1900150 regulation of defense response to fungus Biological Process | |||||||||
| KEGG gene cross-reference | ag:CAB06427 ath:AT3G50280 ath:AT5G23940 ath:AT5G48930 ath:AT5G67160 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF02458Transferase1-89 aaPF02458Transferase87-153 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA07G399720 | PF02458 | Transferase | 1 | 89 | 7e-26 | 91.6 |
| TkA07G399720 | PF02458 | Transferase | 87 | 153 | 7e-26 | 91.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.